Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 161423..161928 | Replicon | chromosome |
Accession | NZ_LT969520 | ||
Organism | Pseudomonas aeruginosa isolate RW109 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | RW109_RS03885 | Protein ID | WP_003083773.1 |
Coordinates | 161423..161704 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | RW109_RS03890 | Protein ID | WP_003083775.1 |
Coordinates | 161701..161928 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RW109_RS03860 | 156674..158023 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
RW109_RS03865 | 158072..158758 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
RW109_RS03870 | 158859..159593 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
RW109_RS03875 | 159797..160183 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
RW109_RS03880 | 160215..161123 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
RW109_RS03885 | 161423..161704 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
RW109_RS03890 | 161701..161928 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
RW109_RS03895 | 162104..162724 | - | 621 | WP_003101226.1 | hypothetical protein | - |
RW109_RS03900 | 162825..163325 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
RW109_RS03905 | 163398..163739 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
RW109_RS03910 | 163821..165248 | - | 1428 | WP_003083784.1 | GABA permease | - |
RW109_RS03915 | 165417..166910 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T293944 WP_003083773.1 NZ_LT969520:c161704-161423 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|