Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 819012..819541 | Replicon | chromosome |
| Accession | NZ_LT963436 | ||
| Organism | Staphylococcus saprophyticus isolate Staphylococcus saprophyticus 883 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DG022_RS03940 | Protein ID | WP_002482752.1 |
| Coordinates | 819179..819541 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A380HJK7 |
| Locus tag | DG022_RS03935 | Protein ID | WP_037538046.1 |
| Coordinates | 819012..819182 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG022_RS03910 | 814743..815222 | + | 480 | WP_011302698.1 | PH domain-containing protein | - |
| DG022_RS03915 | 815215..816753 | + | 1539 | WP_078073322.1 | PH domain-containing protein | - |
| DG022_RS03920 | 816746..817246 | + | 501 | WP_047503185.1 | PH domain-containing protein | - |
| DG022_RS03925 | 817310..817660 | + | 351 | WP_002482750.1 | holo-ACP synthase | - |
| DG022_RS03930 | 817776..818924 | + | 1149 | WP_047503183.1 | alanine racemase | - |
| DG022_RS03935 | 819012..819182 | + | 171 | WP_037538046.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DG022_RS03940 | 819179..819541 | + | 363 | WP_002482752.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DG022_RS03945 | 819878..820879 | + | 1002 | WP_041080774.1 | PP2C family protein-serine/threonine phosphatase | - |
| DG022_RS03950 | 820958..821284 | + | 327 | WP_011302705.1 | anti-sigma factor antagonist | - |
| DG022_RS03955 | 821286..821768 | + | 483 | WP_002482755.1 | anti-sigma B factor RsbW | - |
| DG022_RS03960 | 821743..822513 | + | 771 | WP_002482756.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13498.70 Da Isoelectric Point: 10.3173
>T293939 WP_002482752.1 NZ_LT963436:819179-819541 [Staphylococcus saprophyticus]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDKKMKEVNNAIDISLGLHTIRSHKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDKKMKEVNNAIDISLGLHTIRSHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|