Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/-
Location 22174..22652 Replicon plasmid PP4
Accession NZ_LT963413
Organism Pseudomonas syringae isolate CFBP3840

Toxin (Protein)


Gene name relE Uniprot ID A0A2S4ICR4
Locus tag C6H39_RS30620 Protein ID WP_005730619.1
Coordinates 22174..22467 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2S4HLF9
Locus tag C6H39_RS30625 Protein ID WP_003348562.1
Coordinates 22467..22652 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H39_RS30580 17348..17857 - 510 WP_005735414.1 peptide deformylase -
C6H39_RS30590 18145..19374 - 1230 WP_015062536.1 IS91 family transposase -
C6H39_RS30595 19355..19636 - 282 WP_015062535.1 hypothetical protein -
C6H39_RS31875 19919..20259 + 341 Protein_20 hypothetical protein -
C6H39_RS30605 20375..20647 + 273 WP_060403602.1 hypothetical protein -
C6H39_RS30610 20860..21534 + 675 WP_081080454.1 MobA/MobL family protein -
C6H39_RS30615 21531..22058 - 528 WP_003348567.1 hypothetical protein -
C6H39_RS30620 22174..22467 - 294 WP_005730619.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H39_RS30625 22467..22652 - 186 WP_003348562.1 hypothetical protein Antitoxin
C6H39_RS30630 22739..23032 - 294 WP_060403601.1 HU family DNA-binding protein -
C6H39_RS30635 23355..23636 + 282 WP_015062535.1 hypothetical protein -
C6H39_RS30640 23617..24846 + 1230 WP_015062536.1 IS91 family transposase -
C6H39_RS30645 24949..25030 - 82 Protein_29 DUF159 family protein -
C6H39_RS30650 25027..25389 - 363 Protein_30 lytic transglycosylase domain-containing protein -
C6H39_RS30660 25682..25885 - 204 WP_053486275.1 hypothetical protein -
C6H39_RS30665 26280..26645 + 366 WP_019740136.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..78348 78348
- inside IScluster/Tn - - 18145..24846 6701


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11192.94 Da        Isoelectric Point: 6.2150

>T293937 WP_005730619.1 NZ_LT963413:c22467-22174 [Pseudomonas syringae]
MLPIFWLESADNDLAAIIEYIGLRDIAAAERLWQRLRSIVLPLSEHPYLYAISDRVPGMREIVAHPNYLVFYRVTSTRIE
VVNVVHARQEYPQTGLA

Download         Length: 294 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7134.04 Da        Isoelectric Point: 6.4675

>AT293937 WP_003348562.1 NZ_LT963413:c22652-22467 [Pseudomonas syringae]
MIDRSPIVSEFETEELEANYTAWLRAKVEASLADSRPAIPHDEVERRMAERLARLRHRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4ICR4

Antitoxin

Source ID Structure
AlphaFold DB A0A2S4HLF9

References