Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4695..5331 | Replicon | plasmid PP4 |
Accession | NZ_LT963413 | ||
Organism | Pseudomonas syringae isolate CFBP3840 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2S4IFM0 |
Locus tag | C6H39_RS30505 | Protein ID | WP_044310977.1 |
Coordinates | 5149..5331 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A2S4IFN3 |
Locus tag | C6H39_RS30500 | Protein ID | WP_060404204.1 |
Coordinates | 4695..5117 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H39_RS30485 | 574..1170 | + | 597 | WP_057425230.1 | recombinase family protein | - |
C6H39_RS30490 | 1160..4186 | + | 3027 | WP_060404205.1 | Tn3-like element ISPsy30 family transposase | - |
C6H39_RS30495 | 4218..4529 | - | 312 | Protein_3 | hypothetical protein | - |
C6H39_RS30500 | 4695..5117 | - | 423 | WP_060404204.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
C6H39_RS30505 | 5149..5331 | - | 183 | WP_044310977.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
C6H39_RS30510 | 5624..5905 | + | 282 | WP_060402791.1 | hypothetical protein | - |
C6H39_RS30515 | 5886..7112 | + | 1227 | WP_104721076.1 | IS91 family transposase | - |
C6H39_RS30525 | 7386..7667 | + | 282 | WP_060407302.1 | hypothetical protein | - |
C6H39_RS30530 | 7648..8877 | + | 1230 | WP_104721077.1 | IS91 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..78348 | 78348 | |
- | inside | IScluster/Tn | - | - | 574..12897 | 12323 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6836.96 Da Isoelectric Point: 10.5498
>T293936 WP_044310977.1 NZ_LT963413:c5331-5149 [Pseudomonas syringae]
MKCSEFRRWLQAQGAEFKAAKGSHFKVYLNGKATIFADHGSKEMHEGLRKTIIKQLGLKD
MKCSEFRRWLQAQGAEFKAAKGSHFKVYLNGKATIFADHGSKEMHEGLRKTIIKQLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15616.00 Da Isoelectric Point: 5.1895
>AT293936 WP_060404204.1 NZ_LT963413:c5117-4695 [Pseudomonas syringae]
MYQYPLTQHQEQTGVWLSCPNIPEMNASGETLTEALDEALNGMESALSLYVDQRRKIPQASLPVGDELVMHLPALTVAKI
MLWNSMLDNGVSRAELARRLGCTRQVVDRLVDFLHTSKIEQVERALGLLGRRITLSLEAA
MYQYPLTQHQEQTGVWLSCPNIPEMNASGETLTEALDEALNGMESALSLYVDQRRKIPQASLPVGDELVMHLPALTVAKI
MLWNSMLDNGVSRAELARRLGCTRQVVDRLVDFLHTSKIEQVERALGLLGRRITLSLEAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4IFM0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4IFN3 |