Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 14259..14833 | Replicon | plasmid PP3 |
Accession | NZ_LT963412 | ||
Organism | Pseudomonas syringae isolate CFBP3840 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q48BC5 |
Locus tag | C6H39_RS30115 | Protein ID | WP_003344395.1 |
Coordinates | 14456..14833 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q48BC4 |
Locus tag | C6H39_RS30110 | Protein ID | WP_004644067.1 |
Coordinates | 14259..14459 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H39_RS30095 | 9659..10627 | - | 969 | WP_060402986.1 | hypothetical protein | - |
C6H39_RS30100 | 11004..13094 | - | 2091 | Protein_14 | type IV secretory system conjugative DNA transfer family protein | - |
C6H39_RS30105 | 13081..14166 | - | 1086 | WP_060404100.1 | thioredoxin fold domain-containing protein | - |
C6H39_RS30110 | 14259..14459 | + | 201 | WP_004644067.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
C6H39_RS30115 | 14456..14833 | + | 378 | WP_003344395.1 | PIN domain-containing protein | Toxin |
C6H39_RS30120 | 14823..16025 | - | 1203 | WP_044424879.1 | hypothetical protein | - |
C6H39_RS30125 | 16118..16777 | - | 660 | WP_044424882.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
C6H39_RS30130 | 16764..18908 | - | 2145 | WP_060404099.1 | DotA/TraY family protein | - |
C6H39_RS30135 | 19039..19617 | - | 579 | WP_004642775.1 | conjugal transfer protein TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..86369 | 86369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13633.73 Da Isoelectric Point: 6.4723
>T293934 WP_003344395.1 NZ_LT963412:14456-14833 [Pseudomonas syringae]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B3GPE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4IKB9 |