Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 11473..12020 Replicon plasmid PP2
Accession NZ_LT963411
Organism Pseudomonas syringae isolate CFBP3840

Toxin (Protein)


Gene name mazF Uniprot ID Q48B48
Locus tag C6H39_RS29515 Protein ID WP_003319696.1
Coordinates 11473..11799 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A7V8M172
Locus tag C6H39_RS29520 Protein ID WP_003319697.1
Coordinates 11796..12020 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H39_RS29480 6794..7075 - 282 WP_015062535.1 hypothetical protein -
C6H39_RS29485 7165..7344 + 180 Protein_8 N-acetyltransferase -
C6H39_RS29490 8153..8548 + 396 WP_058886841.1 CesT family type III secretion system chaperone -
C6H39_RS29495 8559..9146 + 588 WP_081080359.1 hypothetical protein -
C6H39_RS29500 9260..10061 - 802 Protein_11 IS3 family transposase -
C6H39_RS29510 10298..11401 - 1104 WP_004663854.1 IS5-like element ISPsy19 family transposase -
C6H39_RS29515 11473..11799 - 327 WP_003319696.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
C6H39_RS29520 11796..12020 - 225 WP_003319697.1 antitoxin MazE family protein Antitoxin
C6H39_RS29525 12293..12925 - 633 WP_024421175.1 recombinase family protein -
C6H39_RS29530 13230..14177 - 948 WP_005769731.1 hypothetical protein -
C6H39_RS29535 14539..14820 - 282 WP_004666803.1 hypothetical protein -
C6H39_RS29540 14820..15503 - 684 WP_002556051.1 AAA family ATPase -
C6H39_RS29545 15898..16098 + 201 WP_002556050.1 molecular chaperone DnaK -
C6H39_RS29550 16136..16357 + 222 WP_004666801.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..90464 90464


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-103)

Antitoxin

Antitoxin MazE-like

(8-72)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11660.71 Da        Isoelectric Point: 8.0546

>T293933 WP_003319696.1 NZ_LT963411:c11799-11473 [Pseudomonas syringae]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN

Download         Length: 327 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8471.61 Da        Isoelectric Point: 6.2008

>AT293933 WP_003319697.1 NZ_LT963411:c12020-11796 [Pseudomonas syringae]
MPTSHVNARVQRHRDALRAAGLRPIQIWVPDTRRPDFAQECHRQCLLVAQADMANTYMQGLMDEALDDVEGWTP

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7V8S2J7

Antitoxin

Source ID Structure
AlphaFold DB A0A7V8M172

References