Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 11473..12020 | Replicon | plasmid PP2 |
Accession | NZ_LT963411 | ||
Organism | Pseudomonas syringae isolate CFBP3840 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q48B48 |
Locus tag | C6H39_RS29515 | Protein ID | WP_003319696.1 |
Coordinates | 11473..11799 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7V8M172 |
Locus tag | C6H39_RS29520 | Protein ID | WP_003319697.1 |
Coordinates | 11796..12020 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H39_RS29480 | 6794..7075 | - | 282 | WP_015062535.1 | hypothetical protein | - |
C6H39_RS29485 | 7165..7344 | + | 180 | Protein_8 | N-acetyltransferase | - |
C6H39_RS29490 | 8153..8548 | + | 396 | WP_058886841.1 | CesT family type III secretion system chaperone | - |
C6H39_RS29495 | 8559..9146 | + | 588 | WP_081080359.1 | hypothetical protein | - |
C6H39_RS29500 | 9260..10061 | - | 802 | Protein_11 | IS3 family transposase | - |
C6H39_RS29510 | 10298..11401 | - | 1104 | WP_004663854.1 | IS5-like element ISPsy19 family transposase | - |
C6H39_RS29515 | 11473..11799 | - | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
C6H39_RS29520 | 11796..12020 | - | 225 | WP_003319697.1 | antitoxin MazE family protein | Antitoxin |
C6H39_RS29525 | 12293..12925 | - | 633 | WP_024421175.1 | recombinase family protein | - |
C6H39_RS29530 | 13230..14177 | - | 948 | WP_005769731.1 | hypothetical protein | - |
C6H39_RS29535 | 14539..14820 | - | 282 | WP_004666803.1 | hypothetical protein | - |
C6H39_RS29540 | 14820..15503 | - | 684 | WP_002556051.1 | AAA family ATPase | - |
C6H39_RS29545 | 15898..16098 | + | 201 | WP_002556050.1 | molecular chaperone DnaK | - |
C6H39_RS29550 | 16136..16357 | + | 222 | WP_004666801.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..90464 | 90464 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T293933 WP_003319696.1 NZ_LT963411:c11799-11473 [Pseudomonas syringae]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8S2J7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8M172 |