Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5870105..5870716 | Replicon | chromosome |
Accession | NZ_LT963409 | ||
Organism | Pseudomonas syringae isolate CFBP3840 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A2G4CXS4 |
Locus tag | C6H39_RS27970 | Protein ID | WP_057456423.1 |
Coordinates | 5870105..5870455 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | C6H39_RS27975 | Protein ID | WP_057432311.1 |
Coordinates | 5870468..5870716 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H39_RS27955 | 5865994..5866785 | + | 792 | WP_057431753.1 | RHS repeat protein | - |
C6H39_RS27960 | 5866782..5869604 | + | 2823 | WP_060403779.1 | RHS repeat protein | - |
C6H39_RS27965 | 5869594..5869998 | + | 405 | WP_057456424.1 | hypothetical protein | - |
C6H39_RS27970 | 5870105..5870455 | - | 351 | WP_057456423.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H39_RS27975 | 5870468..5870716 | - | 249 | WP_057432311.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C6H39_RS27980 | 5871055..5872017 | + | 963 | WP_060403780.1 | tyrosine-type recombinase/integrase | - |
C6H39_RS27985 | 5872202..5872534 | - | 333 | WP_060403781.1 | hypothetical protein | - |
C6H39_RS27990 | 5872948..5874867 | - | 1920 | WP_060403782.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12901.70 Da Isoelectric Point: 4.1824
>T293931 WP_057456423.1 NZ_LT963409:c5870455-5870105 [Pseudomonas syringae]
MNTFALRFTDLAQQSLEDQVEHLAVTQGFSSAAQRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPI
MNTFALRFTDLAQQSLEDQVEHLAVTQGFSSAAQRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|