Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5851445..5852025 | Replicon | chromosome |
Accession | NZ_LT963409 | ||
Organism | Pseudomonas syringae isolate CFBP3840 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A2G4CV40 |
Locus tag | C6H39_RS27890 | Protein ID | WP_044322659.1 |
Coordinates | 5851445..5851744 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A2G4CUT8 |
Locus tag | C6H39_RS27895 | Protein ID | WP_003407168.1 |
Coordinates | 5851741..5852025 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H39_RS27860 | 5848202..5848843 | - | 642 | WP_060403107.1 | SOS response-associated peptidase | - |
C6H39_RS27865 | 5849108..5849359 | - | 252 | WP_003348789.1 | ribbon-helix-helix protein, CopG family | - |
C6H39_RS27870 | 5849448..5850101 | - | 654 | WP_060403115.1 | AAA family ATPase | - |
C6H39_RS27880 | 5850497..5850913 | - | 417 | WP_060403106.1 | hypothetical protein | - |
C6H39_RS27890 | 5851445..5851744 | + | 300 | WP_044322659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H39_RS27895 | 5851741..5852025 | + | 285 | WP_003407168.1 | putative addiction module antidote protein | Antitoxin |
C6H39_RS27900 | 5852100..5852408 | - | 309 | WP_180275929.1 | DUF4113 domain-containing protein | - |
C6H39_RS27905 | 5852781..5853799 | + | 1019 | Protein_5211 | tyrosine protein phosphatase | - |
C6H39_RS27910 | 5854363..5854584 | - | 222 | WP_004666801.1 | hypothetical protein | - |
C6H39_RS27915 | 5854735..5855820 | + | 1086 | WP_002556026.1 | DUF3616 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5849448..5866785 | 17337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11170.80 Da Isoelectric Point: 9.9231
>T293930 WP_044322659.1 NZ_LT963409:5851445-5851744 [Pseudomonas syringae]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4CV40 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4CUT8 |