Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 250324..250843 | Replicon | chromosome |
| Accession | NZ_LT963409 | ||
| Organism | Pseudomonas syringae isolate CFBP3840 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q48Q48 |
| Locus tag | C6H39_RS01170 | Protein ID | WP_002551445.1 |
| Coordinates | 250553..250843 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S6UWW5 |
| Locus tag | C6H39_RS01165 | Protein ID | WP_002551444.1 |
| Coordinates | 250324..250563 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H39_RS01145 | 247075..248349 | + | 1275 | WP_004667253.1 | OprD family porin | - |
| C6H39_RS01150 | 248383..248877 | - | 495 | WP_004667254.1 | hypothetical protein | - |
| C6H39_RS01155 | 249037..249585 | + | 549 | WP_044318253.1 | GNAT family N-acetyltransferase | - |
| C6H39_RS01160 | 249687..250160 | + | 474 | WP_002551443.1 | GNAT family N-acetyltransferase | - |
| C6H39_RS01165 | 250324..250563 | + | 240 | WP_002551444.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| C6H39_RS01170 | 250553..250843 | + | 291 | WP_002551445.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H39_RS01180 | 251076..251813 | - | 738 | WP_060403416.1 | hypothetical protein | - |
| C6H39_RS01185 | 252119..252541 | - | 423 | WP_005746664.1 | DUF1493 family protein | - |
| C6H39_RS01195 | 253124..254623 | + | 1500 | WP_103356851.1 | IS21 family transposase | - |
| C6H39_RS01200 | 254616..255419 | + | 804 | WP_003417182.1 | IS21-like element ISPsy20 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11316.19 Da Isoelectric Point: 10.2579
>T293929 WP_002551445.1 NZ_LT963409:250553-250843 [Pseudomonas syringae]
MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREEVYRKATDRLGR
MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREEVYRKATDRLGR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4DBS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8M1G9 |