Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 6093410..6093929 Replicon chromosome
Accession NZ_LT963408
Organism Pseudomonas syringae group genomosp. 3 isolate CFBP6411

Toxin (Protein)


Gene name relE Uniprot ID A0A2S4HX27
Locus tag C6H37_RS29375 Protein ID WP_005737226.1
Coordinates 6093410..6093700 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S6UWW5
Locus tag C6H37_RS29380 Protein ID WP_002551444.1
Coordinates 6093690..6093929 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H37_RS29345 6089730..6090272 + 543 WP_005737222.1 hypothetical protein -
C6H37_RS29350 6090367..6090996 + 630 WP_005737223.1 NAD(P)H-dependent oxidoreductase -
C6H37_RS29355 6091055..6091669 - 615 WP_005737224.1 histidine phosphatase family protein -
C6H37_RS29360 6091746..6092087 - 342 WP_003380754.1 hypothetical protein -
C6H37_RS29365 6092444..6093181 + 738 WP_005737225.1 hypothetical protein -
C6H37_RS29370 6093203..6093322 - 120 Protein_5436 GNAT family N-acetyltransferase -
C6H37_RS29375 6093410..6093700 - 291 WP_005737226.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H37_RS29380 6093690..6093929 - 240 WP_002551444.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
C6H37_RS29385 6094105..6094458 - 354 WP_099160269.1 GNAT family N-acetyltransferase -
C6H37_RS29390 6094598..6096037 - 1440 WP_005737228.1 putative DNA binding domain-containing protein -
C6H37_RS29395 6096030..6096662 - 633 WP_005737229.1 DUF4062 domain-containing protein -
C6H37_RS29400 6096850..6097389 - 540 WP_005737230.1 GNAT family N-acetyltransferase -
C6H37_RS29405 6097550..6098044 + 495 WP_005621707.1 hypothetical protein -
C6H37_RS29410 6098317..6098664 + 348 WP_003380765.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-81)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11092.93 Da        Isoelectric Point: 9.7063

>T293928 WP_005737226.1 NZ_LT963408:c6093700-6093410 [Pseudomonas syringae group genomosp. 3]
MTYSLEFDARALKEWHKLGDTVRQQLKKKLATILVAPCVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLGG

Download         Length: 291 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8955.34 Da        Isoelectric Point: 4.6017

>AT293928 WP_002551444.1 NZ_LT963408:c6093929-6093690 [Pseudomonas syringae group genomosp. 3]
MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLPFKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4HX27

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8M1G9

References