Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 6093410..6093929 | Replicon | chromosome |
| Accession | NZ_LT963408 | ||
| Organism | Pseudomonas syringae group genomosp. 3 isolate CFBP6411 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2S4HX27 |
| Locus tag | C6H37_RS29375 | Protein ID | WP_005737226.1 |
| Coordinates | 6093410..6093700 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S6UWW5 |
| Locus tag | C6H37_RS29380 | Protein ID | WP_002551444.1 |
| Coordinates | 6093690..6093929 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H37_RS29345 | 6089730..6090272 | + | 543 | WP_005737222.1 | hypothetical protein | - |
| C6H37_RS29350 | 6090367..6090996 | + | 630 | WP_005737223.1 | NAD(P)H-dependent oxidoreductase | - |
| C6H37_RS29355 | 6091055..6091669 | - | 615 | WP_005737224.1 | histidine phosphatase family protein | - |
| C6H37_RS29360 | 6091746..6092087 | - | 342 | WP_003380754.1 | hypothetical protein | - |
| C6H37_RS29365 | 6092444..6093181 | + | 738 | WP_005737225.1 | hypothetical protein | - |
| C6H37_RS29370 | 6093203..6093322 | - | 120 | Protein_5436 | GNAT family N-acetyltransferase | - |
| C6H37_RS29375 | 6093410..6093700 | - | 291 | WP_005737226.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H37_RS29380 | 6093690..6093929 | - | 240 | WP_002551444.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| C6H37_RS29385 | 6094105..6094458 | - | 354 | WP_099160269.1 | GNAT family N-acetyltransferase | - |
| C6H37_RS29390 | 6094598..6096037 | - | 1440 | WP_005737228.1 | putative DNA binding domain-containing protein | - |
| C6H37_RS29395 | 6096030..6096662 | - | 633 | WP_005737229.1 | DUF4062 domain-containing protein | - |
| C6H37_RS29400 | 6096850..6097389 | - | 540 | WP_005737230.1 | GNAT family N-acetyltransferase | - |
| C6H37_RS29405 | 6097550..6098044 | + | 495 | WP_005621707.1 | hypothetical protein | - |
| C6H37_RS29410 | 6098317..6098664 | + | 348 | WP_003380765.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11092.93 Da Isoelectric Point: 9.7063
>T293928 WP_005737226.1 NZ_LT963408:c6093700-6093410 [Pseudomonas syringae group genomosp. 3]
MTYSLEFDARALKEWHKLGDTVRQQLKKKLATILVAPCVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLGG
MTYSLEFDARALKEWHKLGDTVRQQLKKKLATILVAPCVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLGG
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4HX27 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8M1G9 |