Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4361226..4361837 | Replicon | chromosome |
Accession | NZ_LT963408 | ||
Organism | Pseudomonas syringae group genomosp. 3 isolate CFBP6411 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A2S4HLU6 |
Locus tag | C6H37_RS20950 | Protein ID | WP_005735311.1 |
Coordinates | 4361487..4361837 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A3M4KYK1 |
Locus tag | C6H37_RS20945 | Protein ID | WP_005735310.1 |
Coordinates | 4361226..4361474 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H37_RS20925 | 4358342..4359409 | + | 1068 | WP_104698607.1 | IS630 family transposase | - |
C6H37_RS20930 | 4359435..4359803 | + | 369 | Protein_3873 | DUF2778 domain-containing protein | - |
C6H37_RS20935 | 4359803..4360132 | + | 330 | WP_005735474.1 | hypothetical protein | - |
C6H37_RS20940 | 4360328..4361065 | + | 738 | WP_103379577.1 | IS5 family transposase | - |
C6H37_RS20945 | 4361226..4361474 | + | 249 | WP_005735310.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C6H37_RS20950 | 4361487..4361837 | + | 351 | WP_005735311.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H37_RS31005 | 4361943..4362239 | - | 297 | WP_146048105.1 | hypothetical protein | - |
C6H37_RS20960 | 4362644..4363003 | + | 360 | Protein_3879 | helix-turn-helix domain containing protein | - |
C6H37_RS20965 | 4363091..4363447 | + | 357 | WP_078983211.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C6H37_RS20970 | 4363465..4364997 | + | 1533 | WP_104698608.1 | IS66 family transposase | - |
C6H37_RS20975 | 4365043..4365759 | + | 717 | Protein_3882 | IS630 family transposase | - |
C6H37_RS31310 | 4366453..4366692 | + | 240 | WP_005740586.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4358678..4365759 | 7081 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12901.70 Da Isoelectric Point: 4.1824
>T293927 WP_005735311.1 NZ_LT963408:4361487-4361837 [Pseudomonas syringae group genomosp. 3]
MNTFALRFTDVAQQSLEDQVEHLAVTQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPI
MNTFALRFTDVAQQSLEDQVEHLAVTQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4HLU6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M4KYK1 |