Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1096953..1097494 | Replicon | chromosome |
Accession | NZ_LT963408 | ||
Organism | Pseudomonas syringae group genomosp. 3 isolate CFBP6411 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2K4W910 |
Locus tag | C6H37_RS05615 | Protein ID | WP_060402130.1 |
Coordinates | 1096953..1097228 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2S4IDD5 |
Locus tag | C6H37_RS05620 | Protein ID | WP_005736615.1 |
Coordinates | 1097228..1097494 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H37_RS05585 | 1092083..1093108 | - | 1026 | WP_104698281.1 | TRAP transporter substrate-binding protein | - |
C6H37_RS05590 | 1093166..1094050 | - | 885 | WP_005736620.1 | SMP-30/gluconolactonase/LRE family protein | - |
C6H37_RS05595 | 1094107..1094934 | - | 828 | WP_005736619.1 | NAD(P)-dependent oxidoreductase | - |
C6H37_RS05600 | 1095113..1096381 | - | 1269 | WP_017698468.1 | OprD family porin | - |
C6H37_RS05615 | 1096953..1097228 | - | 276 | WP_060402130.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H37_RS05620 | 1097228..1097494 | - | 267 | WP_005736615.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
C6H37_RS05625 | 1097659..1099581 | - | 1923 | WP_017700186.1 | methyl-accepting chemotaxis protein | - |
C6H37_RS05630 | 1099940..1101820 | + | 1881 | WP_005736612.1 | methyl-accepting chemotaxis protein | - |
C6H37_RS05635 | 1101949..1102212 | - | 264 | WP_005736610.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10683.37 Da Isoelectric Point: 7.0121
>T293926 WP_060402130.1 NZ_LT963408:c1097228-1096953 [Pseudomonas syringae group genomosp. 3]
MELMWTSKALSDVARLYDFLAVASQPAAAQTVQKLTAAPIMLLSNPRIGERLEEFEPRDVRKIQIGRYEMRYEIVDSTIY
LLRLWHTREDR
MELMWTSKALSDVARLYDFLAVASQPAAAQTVQKLTAAPIMLLSNPRIGERLEEFEPRDVRKIQIGRYEMRYEIVDSTIY
LLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4W910 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4IDD5 |