Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 547143..547754 | Replicon | chromosome |
| Accession | NZ_LT963408 | ||
| Organism | Pseudomonas syringae group genomosp. 3 isolate CFBP6411 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | Q4ZME8 |
| Locus tag | C6H37_RS02810 | Protein ID | WP_003304103.1 |
| Coordinates | 547404..547754 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | Q4ZME7 |
| Locus tag | C6H37_RS02805 | Protein ID | WP_002556076.1 |
| Coordinates | 547143..547391 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H37_RS02780 | 542376..543272 | + | 897 | WP_017709553.1 | LysR family transcriptional regulator | - |
| C6H37_RS02785 | 543430..544422 | + | 993 | WP_017709554.1 | YncE family protein | - |
| C6H37_RS02790 | 544748..545128 | + | 381 | WP_010924793.1 | hypothetical protein | - |
| C6H37_RS02795 | 545609..545815 | + | 207 | WP_161806366.1 | hypothetical protein | - |
| C6H37_RS02800 | 545844..546806 | - | 963 | WP_010924794.1 | tyrosine-type recombinase/integrase | - |
| C6H37_RS02805 | 547143..547391 | + | 249 | WP_002556076.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| C6H37_RS02810 | 547404..547754 | + | 351 | WP_003304103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H37_RS02815 | 548117..548338 | - | 222 | WP_003422691.1 | hypothetical protein | - |
| C6H37_RS02820 | 548406..549791 | - | 1386 | WP_103365183.1 | P-type conjugative transfer protein TrbL | - |
| C6H37_RS02825 | 549995..550750 | - | 756 | WP_088234448.1 | P-type conjugative transfer protein TrbJ | - |
| C6H37_RS02830 | 550791..551165 | - | 375 | WP_088234449.1 | conjugal transfer transcriptional regulator TraJ | - |
| C6H37_RS02835 | 551458..551736 | - | 279 | WP_088234450.1 | conjugal transfer protein TraK | - |
| C6H37_RS02840 | 551803..552528 | - | 726 | WP_088236353.1 | phage replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 523659..554242 | 30583 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12973.76 Da Isoelectric Point: 4.7690
>T293925 WP_003304103.1 NZ_LT963408:547404-547754 [Pseudomonas syringae group genomosp. 3]
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P9GDS9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P9GM89 |