Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PfiT-PfiA/ParE(toxin)
Location 547143..547754 Replicon chromosome
Accession NZ_LT963408
Organism Pseudomonas syringae group genomosp. 3 isolate CFBP6411

Toxin (Protein)


Gene name PfiT Uniprot ID Q4ZME8
Locus tag C6H37_RS02810 Protein ID WP_003304103.1
Coordinates 547404..547754 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name PfiA Uniprot ID Q4ZME7
Locus tag C6H37_RS02805 Protein ID WP_002556076.1
Coordinates 547143..547391 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H37_RS02780 542376..543272 + 897 WP_017709553.1 LysR family transcriptional regulator -
C6H37_RS02785 543430..544422 + 993 WP_017709554.1 YncE family protein -
C6H37_RS02790 544748..545128 + 381 WP_010924793.1 hypothetical protein -
C6H37_RS02795 545609..545815 + 207 WP_161806366.1 hypothetical protein -
C6H37_RS02800 545844..546806 - 963 WP_010924794.1 tyrosine-type recombinase/integrase -
C6H37_RS02805 547143..547391 + 249 WP_002556076.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
C6H37_RS02810 547404..547754 + 351 WP_003304103.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H37_RS02815 548117..548338 - 222 WP_003422691.1 hypothetical protein -
C6H37_RS02820 548406..549791 - 1386 WP_103365183.1 P-type conjugative transfer protein TrbL -
C6H37_RS02825 549995..550750 - 756 WP_088234448.1 P-type conjugative transfer protein TrbJ -
C6H37_RS02830 550791..551165 - 375 WP_088234449.1 conjugal transfer transcriptional regulator TraJ -
C6H37_RS02835 551458..551736 - 279 WP_088234450.1 conjugal transfer protein TraK -
C6H37_RS02840 551803..552528 - 726 WP_088236353.1 phage replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 523659..554242 30583


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12973.76 Da        Isoelectric Point: 4.7690

>T293925 WP_003304103.1 NZ_LT963408:547404-547754 [Pseudomonas syringae group genomosp. 3]
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI

Download         Length: 351 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9366.73 Da        Isoelectric Point: 9.9579

>AT293925 WP_002556076.1 NZ_LT963408:547143-547391 [Pseudomonas syringae group genomosp. 3]
MRVETISFLKRNAADLPLDEPLVVTQNGVPAYVVESYADRKRRDESIALVKLLAISSREYSQGKHCSTDELKARLSRRFT
QK

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P9GDS9

Antitoxin

Source ID Structure
AlphaFold DB A0A0P9GM89

References