Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 525069..526108 | Replicon | chromosome |
Accession | NZ_LT963408 | ||
Organism | Pseudomonas syringae group genomosp. 3 isolate CFBP6411 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | C6H37_RS02650 | Protein ID | WP_005737551.1 |
Coordinates | 525533..526108 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A2G9KX16 |
Locus tag | C6H37_RS02645 | Protein ID | WP_005737550.1 |
Coordinates | 525069..525536 (+) | Length | 156 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H37_RS02630 | 522947..523564 | + | 618 | WP_005737548.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
C6H37_RS02635 | 523659..524252 | - | 594 | WP_005737549.1 | hypothetical protein | - |
C6H37_RS31155 | 524309..524794 | - | 486 | Protein_479 | hypothetical protein | - |
C6H37_RS02645 | 525069..525536 | + | 468 | WP_005737550.1 | helix-turn-helix domain-containing protein | Antitoxin |
C6H37_RS02650 | 525533..526108 | + | 576 | WP_005737551.1 | PIN domain-containing protein | Toxin |
C6H37_RS02655 | 526289..526540 | + | 252 | WP_005737552.1 | helix-turn-helix domain-containing protein | - |
C6H37_RS02660 | 526540..527736 | + | 1197 | WP_005737554.1 | type II toxin-antitoxin system HipA family toxin | - |
C6H37_RS02665 | 527857..528141 | + | 285 | Protein_484 | N-acetylmuramoyl-L-alanine amidase | - |
C6H37_RS02670 | 528157..528906 | - | 750 | WP_103377603.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 523659..554242 | 30583 | |
- | flank | IS/Tn | - | - | 528157..528906 | 749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21944.11 Da Isoelectric Point: 5.5934
>T293924 WP_005737551.1 NZ_LT963408:525533-526108 [Pseudomonas syringae group genomosp. 3]
MRHSPFTAFYDANVLYPAPLRDFLMHLALTGVYRARWSSQIHDEWKRNLLINRPELTREQLDRTSALMDKAVPDGLVSDY
QSLIEGLKLPDADDRHVLAAAIKCNASVIVTFNLKDFPKDVLDTFDMEPLHPDDFIADLWDLDKAAVLEAAQRQRASLRN
PAHSARQYLDKLLQQKLPETVKLLSDFEFLI
MRHSPFTAFYDANVLYPAPLRDFLMHLALTGVYRARWSSQIHDEWKRNLLINRPELTREQLDRTSALMDKAVPDGLVSDY
QSLIEGLKLPDADDRHVLAAAIKCNASVIVTFNLKDFPKDVLDTFDMEPLHPDDFIADLWDLDKAAVLEAAQRQRASLRN
PAHSARQYLDKLLQQKLPETVKLLSDFEFLI
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17233.75 Da Isoelectric Point: 5.2911
>AT293924 WP_005737550.1 NZ_LT963408:525069-525536 [Pseudomonas syringae group genomosp. 3]
MSSADATRTVLPGEKEIAAAVESSRQLAAFLTTKCDTQRIELVDETQQREVVELPMFALRLLGEILSELALGNAVKVVPI
HAELTTQEAADMLNVSRPHLVKMLDQGMLPHTKTGRHRRVKFADLMSYKQQRDQASREAMDELAAQAQELGMGYE
MSSADATRTVLPGEKEIAAAVESSRQLAAFLTTKCDTQRIELVDETQQREVVELPMFALRLLGEILSELALGNAVKVVPI
HAELTTQEAADMLNVSRPHLVKMLDQGMLPHTKTGRHRRVKFADLMSYKQQRDQASREAMDELAAQAQELGMGYE
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|