Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2552..3225 | Replicon | plasmid PP5 |
Accession | NZ_LT963407 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2K4W4Y6 |
Locus tag | C6H38_RS31600 | Protein ID | WP_060412717.1 |
Coordinates | 2552..2971 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | C6H38_RS31605 | Protein ID | WP_060412719.1 |
Coordinates | 2968..3225 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS31590 | 686..1621 | - | 936 | WP_060412716.1 | syringolide biosynthetic protein AvrD1 | - |
C6H38_RS31595 | 1896..2511 | - | 616 | Protein_2 | recombinase family protein | - |
C6H38_RS31600 | 2552..2971 | - | 420 | WP_060412717.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
C6H38_RS31605 | 2968..3225 | - | 258 | WP_060412719.1 | Arc family DNA-binding protein | Antitoxin |
C6H38_RS31610 | 3593..4225 | + | 633 | WP_003381804.1 | ParA family protein | - |
C6H38_RS31615 | 4261..4515 | + | 255 | WP_003381801.1 | hypothetical protein | - |
C6H38_RS31620 | 4939..5604 | - | 666 | WP_060412718.1 | LexA family transcriptional regulator | - |
C6H38_RS31625 | 5692..5922 | + | 231 | WP_010215521.1 | helix-turn-helix domain-containing protein | - |
C6H38_RS31630 | 6273..6980 | + | 708 | WP_103724609.1 | lytic transglycosylase domain-containing protein | - |
C6H38_RS31635 | 6980..7315 | + | 336 | WP_103724610.1 | conjugal transfer protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..41285 | 41285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15168.46 Da Isoelectric Point: 4.7010
>T293922 WP_060412717.1 NZ_LT963407:c2971-2552 [Pseudomonas syringae pv. avii]
MILLDTNVISEPQRREPNAHVLDWIDAQALETLYLSTITVAELRAGIALMPVGKRQDSLRENLEKHLLPMFANRVLSFDM
TCTKTYAELLAKSRAAGLAVETADAFIAAIALANGFTVATRDTGPFEAAGLNVINPWEA
MILLDTNVISEPQRREPNAHVLDWIDAQALETLYLSTITVAELRAGIALMPVGKRQDSLRENLEKHLLPMFANRVLSFDM
TCTKTYAELLAKSRAAGLAVETADAFIAAIALANGFTVATRDTGPFEAAGLNVINPWEA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|