Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 59459..60039 Replicon plasmid PP4
Accession NZ_LT963406
Organism Pseudomonas syringae pv. avii isolate CFBP3846

Toxin (Protein)


Gene name PumA Uniprot ID Q48B35
Locus tag C6H38_RS31455 Protein ID WP_011282511.1
Coordinates 59740..60039 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag C6H38_RS31450 Protein ID WP_003348777.1
Coordinates 59459..59743 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H38_RS31405 54691..54984 - 294 WP_060412319.1 hypothetical protein -
C6H38_RS31410 55087..56103 - 1017 WP_031598824.1 hypothetical protein -
C6H38_RS31415 56139..56339 - 201 WP_031598826.1 type IV secretory system conjugative DNA transfer family protein -
C6H38_RS31420 56339..56572 - 234 WP_060412318.1 hypothetical protein -
C6H38_RS31430 57044..57853 - 810 WP_104698146.1 IS21-like element ISPsy4 family helper ATPase IstB -
C6H38_RS31435 57850..58872 - 1023 WP_002551322.1 IS21-like element ISPsy4 family transposase -
C6H38_RS31440 58961..59044 + 84 Protein_72 DUF4113 domain-containing protein -
C6H38_RS31445 59118..59387 + 270 WP_003348774.1 hypothetical protein -
C6H38_RS31450 59459..59743 - 285 WP_003348777.1 putative addiction module antidote protein Antitoxin
C6H38_RS31455 59740..60039 - 300 WP_011282511.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H38_RS31460 60420..61175 - 756 WP_060402572.1 IS21-like element ISPsy14 family helper ATPase IstB -
C6H38_RS31465 61196..62710 - 1515 WP_005740312.1 IS21 family transposase -
C6H38_RS31475 63154..63570 + 417 WP_003348781.1 hypothetical protein -
C6H38_RS31485 63965..64618 + 654 WP_003348786.1 AAA family ATPase -
C6H38_RS31490 64707..64958 + 252 WP_003348789.1 ribbon-helix-helix protein, CopG family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..77492 77492
- inside IScluster/Tn - - 57044..74571 17527


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-96)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11168.79 Da        Isoelectric Point: 10.2231

>T293921 WP_011282511.1 NZ_LT963406:c60039-59740 [Pseudomonas syringae pv. avii]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKRLADQWRQE

Download         Length: 300 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10263.80 Da        Isoelectric Point: 5.0916

>AT293921 WP_003348777.1 NZ_LT963406:c59743-59459 [Pseudomonas syringae pv. avii]
MKEQIFDYDPAAALDGPEAIAIFISDAFETGDAEYIAKAMGVVARAKGMSELARETGLSREQLYRSFSSKGNPTLKTMLT
VMRALGVDMTARMH

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M3YY44

Antitoxin

Source ID Structure

References