Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 12462..12940 | Replicon | plasmid PP4 |
| Accession | NZ_LT963406 | ||
| Organism | Pseudomonas syringae pv. avii isolate CFBP3846 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | C6H38_RS31110 | Protein ID | WP_002555994.1 |
| Coordinates | 12662..12940 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | H1ZX71 |
| Locus tag | C6H38_RS31105 | Protein ID | WP_002555995.1 |
| Coordinates | 12462..12662 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H38_RS31080 | 8651..9211 | - | 561 | WP_005737570.1 | recombinase family protein | - |
| C6H38_RS31090 | 9951..10616 | + | 666 | WP_032641726.1 | hypothetical protein | - |
| C6H38_RS32345 | 10772..10936 | + | 165 | WP_004666862.1 | hypothetical protein | - |
| C6H38_RS31095 | 10970..11197 | - | 228 | Protein_11 | IS21-like element ISPsy4 family helper ATPase IstB | - |
| C6H38_RS31100 | 11194..12216 | - | 1023 | WP_002551322.1 | IS21-like element ISPsy4 family transposase | - |
| C6H38_RS31105 | 12462..12662 | + | 201 | WP_002555995.1 | hypothetical protein | Antitoxin |
| C6H38_RS31110 | 12662..12940 | + | 279 | WP_002555994.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H38_RS31115 | 13345..14859 | + | 1515 | WP_005740312.1 | IS21 family transposase | - |
| C6H38_RS31120 | 14880..15635 | + | 756 | WP_060402572.1 | IS21-like element ISPsy14 family helper ATPase IstB | - |
| C6H38_RS31130 | 15842..16915 | + | 1074 | Protein_17 | hypothetical protein | - |
| C6H38_RS31135 | 17034..17291 | + | 258 | WP_053479520.1 | transcriptional regulator | - |
| C6H38_RS32785 | 17368..17505 | + | 138 | WP_172678953.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..77492 | 77492 | |
| - | inside | IScluster/Tn | - | - | 5681..15635 | 9954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10732.51 Da Isoelectric Point: 10.0464
>T293920 WP_002555994.1 NZ_LT963406:12662-12940 [Pseudomonas syringae pv. avii]
MQIIWRQRARMSLAKIIRYISNEDPQAAQAILERLQSAILPVADHPYLYRPGRVPGTRELVAHPNYVLVYRVTLERIEVV
NVIHARQEYPSL
MQIIWRQRARMSLAKIIRYISNEDPQAAQAILERLQSAILPVADHPYLYRPGRVPGTRELVAHPNYVLVYRVTLERIEVV
NVIHARQEYPSL
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|