Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 12462..12940 Replicon plasmid PP4
Accession NZ_LT963406
Organism Pseudomonas syringae pv. avii isolate CFBP3846

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag C6H38_RS31110 Protein ID WP_002555994.1
Coordinates 12662..12940 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H1ZX71
Locus tag C6H38_RS31105 Protein ID WP_002555995.1
Coordinates 12462..12662 (+) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H38_RS31080 8651..9211 - 561 WP_005737570.1 recombinase family protein -
C6H38_RS31090 9951..10616 + 666 WP_032641726.1 hypothetical protein -
C6H38_RS32345 10772..10936 + 165 WP_004666862.1 hypothetical protein -
C6H38_RS31095 10970..11197 - 228 Protein_11 IS21-like element ISPsy4 family helper ATPase IstB -
C6H38_RS31100 11194..12216 - 1023 WP_002551322.1 IS21-like element ISPsy4 family transposase -
C6H38_RS31105 12462..12662 + 201 WP_002555995.1 hypothetical protein Antitoxin
C6H38_RS31110 12662..12940 + 279 WP_002555994.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H38_RS31115 13345..14859 + 1515 WP_005740312.1 IS21 family transposase -
C6H38_RS31120 14880..15635 + 756 WP_060402572.1 IS21-like element ISPsy14 family helper ATPase IstB -
C6H38_RS31130 15842..16915 + 1074 Protein_17 hypothetical protein -
C6H38_RS31135 17034..17291 + 258 WP_053479520.1 transcriptional regulator -
C6H38_RS32785 17368..17505 + 138 WP_172678953.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..77492 77492
- inside IScluster/Tn - - 5681..15635 9954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10732.51 Da        Isoelectric Point: 10.0464

>T293920 WP_002555994.1 NZ_LT963406:12662-12940 [Pseudomonas syringae pv. avii]
MQIIWRQRARMSLAKIIRYISNEDPQAAQAILERLQSAILPVADHPYLYRPGRVPGTRELVAHPNYVLVYRVTLERIEVV
NVIHARQEYPSL

Download         Length: 279 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7450.22 Da        Isoelectric Point: 4.0927

>AT293920 WP_002555995.1 NZ_LT963406:12462-12662 [Pseudomonas syringae pv. avii]
MANLSPIVSEFETDEQAASYDRWFRLQVQASLDDPSPGVPHDQVMAEMDAIIAEAEKRQQDRTKVS

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A554FZT6

References