Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
Location | 70691..71302 | Replicon | plasmid PP3 |
Accession | NZ_LT963405 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A3M3YY90 |
Locus tag | C6H38_RS30770 | Protein ID | WP_058398778.1 |
Coordinates | 70952..71302 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | I3W0K1 |
Locus tag | C6H38_RS30765 | Protein ID | WP_005618754.1 |
Coordinates | 70691..70939 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS30740 | 65933..66829 | + | 897 | WP_003317531.1 | LysR family transcriptional regulator | - |
C6H38_RS30745 | 66987..67979 | + | 993 | WP_003317529.1 | YncE family protein | - |
C6H38_RS30750 | 68309..68689 | + | 381 | WP_003317528.1 | hypothetical protein | - |
C6H38_RS30760 | 69404..70366 | - | 963 | WP_060413825.1 | tyrosine-type recombinase/integrase | - |
C6H38_RS30765 | 70691..70939 | + | 249 | WP_005618754.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C6H38_RS30770 | 70952..71302 | + | 351 | WP_058398778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H38_RS30775 | 71433..72206 | - | 774 | WP_058398777.1 | helix-turn-helix transcriptional regulator | - |
C6H38_RS30780 | 72315..72716 | + | 402 | Protein_78 | polyamine ABC transporter substrate-binding protein | - |
C6H38_RS30785 | 72765..73574 | - | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
C6H38_RS30790 | 73571..74593 | - | 1023 | WP_002551322.1 | IS21-like element ISPsy4 family transposase | - |
C6H38_RS30795 | 74746..74940 | - | 195 | WP_054086142.1 | hypothetical protein | - |
C6H38_RS30800 | 74937..75227 | - | 291 | WP_046835519.1 | hypothetical protein | - |
C6H38_RS30805 | 75301..75666 | - | 366 | WP_054999222.1 | hypothetical protein | - |
C6H38_RS30810 | 75651..76043 | - | 393 | WP_060414197.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..108842 | 108842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12978.87 Da Isoelectric Point: 4.1953
>T293919 WP_058398778.1 NZ_LT963405:70952-71302 [Pseudomonas syringae pv. avii]
MNTFALRFTDVAQQSLEDQVEHLAVTQGLSSAAQRIDILIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMQSVDIDEIVISLVLGGKQSVEQALIRYCLLQPI
MNTFALRFTDVAQQSLEDQVEHLAVTQGLSSAAQRIDILIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMQSVDIDEIVISLVLGGKQSVEQALIRYCLLQPI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3YY90 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3Z0L4 |