Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 321..868 | Replicon | plasmid PP3 |
| Accession | NZ_LT963405 | ||
| Organism | Pseudomonas syringae pv. avii isolate CFBP3846 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q48B48 |
| Locus tag | C6H38_RS30350 | Protein ID | WP_003319696.1 |
| Coordinates | 321..647 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | H1ZWZ3 |
| Locus tag | C6H38_RS30355 | Protein ID | WP_015060676.1 |
| Coordinates | 644..868 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H38_RS30350 | 321..647 | - | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| C6H38_RS30355 | 644..868 | - | 225 | WP_015060676.1 | antitoxin MazE family protein | Antitoxin |
| C6H38_RS30360 | 1114..1749 | + | 636 | WP_060402215.1 | recombinase family protein | - |
| C6H38_RS30370 | 2921..3289 | + | 369 | WP_003348806.1 | hypothetical protein | - |
| C6H38_RS30375 | 3351..4013 | - | 663 | Protein_5 | Tn3 family transposase | - |
| C6H38_RS30380 | 4085..4738 | - | 654 | WP_044311043.1 | type III effector HopAZ1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..108842 | 108842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T293918 WP_003319696.1 NZ_LT963405:c647-321 [Pseudomonas syringae pv. avii]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V8S2J7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330JWK7 |