Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 97985..98432 Replicon plasmid PP2
Accession NZ_LT963404
Organism Pseudomonas syringae pv. avii isolate CFBP3846

Toxin (Protein)


Gene name relE Uniprot ID A0A3M4C5F0
Locus tag C6H38_RS30260 Protein ID WP_003348606.1
Coordinates 97985..98257 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M4C5H0
Locus tag C6H38_RS30265 Protein ID WP_005730485.1
Coordinates 98247..98432 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H38_RS30225 93626..93850 + 225 WP_044311068.1 carbon storage regulator -
C6H38_RS30230 93934..95481 + 1548 WP_060412996.1 glycoside hydrolase family 28 protein -
C6H38_RS30235 95507..95635 + 129 Protein_99 DUF4113 domain-containing protein -
C6H38_RS30245 96004..96402 - 399 Protein_100 transposase -
C6H38_RS30250 96790..97123 - 334 Protein_101 transposase -
C6H38_RS30255 97168..97881 - 714 WP_044311048.1 UPF0149 family protein -
C6H38_RS30260 97985..98257 - 273 WP_003348606.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H38_RS30265 98247..98432 - 186 WP_005730485.1 hypothetical protein Antitoxin
C6H38_RS30270 98483..98761 - 279 WP_003320513.1 hypothetical protein -
C6H38_RS30275 98854..99489 - 636 WP_103724617.1 recombinase family protein -
C6H38_RS30280 99745..101300 + 1556 WP_103724633.1 IS3-like element IS1240 family transposase -
C6H38_RS30290 101869..102350 + 482 Protein_108 transposase -
C6H38_RS30295 102456..103211 - 756 WP_060402572.1 IS21-like element ISPsy14 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..109843 109843
- inside IScluster/Tn - - 89335..109215 19880


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10199.67 Da        Isoelectric Point: 5.0749

>T293917 WP_003348606.1 NZ_LT963404:c98257-97985 [Pseudomonas syringae pv. avii]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIL
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7292.18 Da        Isoelectric Point: 7.2040

>AT293917 WP_005730485.1 NZ_LT963404:c98432-98247 [Pseudomonas syringae pv. avii]
MSIQLDPRVSEFETQEQADNYDRWFRQRIEHSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M4C5F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4C5H0

References