Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 36346..36920 | Replicon | plasmid PP1 |
| Accession | NZ_LT963403 | ||
| Organism | Pseudomonas syringae pv. avii isolate CFBP3846 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q88BR5 |
| Locus tag | C6H38_RS29595 | Protein ID | WP_011106996.1 |
| Coordinates | 36543..36920 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2K4U5C7 |
| Locus tag | C6H38_RS29590 | Protein ID | WP_031598125.1 |
| Coordinates | 36346..36546 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H38_RS29570 | 31860..32423 | - | 564 | WP_060402321.1 | hypothetical protein | - |
| C6H38_RS29575 | 32444..32866 | - | 423 | WP_060413928.1 | hypothetical protein | - |
| C6H38_RS29580 | 32894..35182 | - | 2289 | WP_103379297.1 | type IV secretory system conjugative DNA transfer family protein | - |
| C6H38_RS29585 | 35169..36254 | - | 1086 | WP_104698132.1 | thioredoxin fold domain-containing protein | - |
| C6H38_RS29590 | 36346..36546 | + | 201 | WP_031598125.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| C6H38_RS29595 | 36543..36920 | + | 378 | WP_011106996.1 | PIN domain-containing protein | Toxin |
| C6H38_RS29600 | 36910..38112 | - | 1203 | WP_103724603.1 | conjugal transfer protein | - |
| C6H38_RS29605 | 38205..38855 | - | 651 | WP_060413746.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| C6H38_RS29610 | 38852..39097 | - | 246 | WP_003344389.1 | hypothetical protein | - |
| C6H38_RS29615 | 39199..41343 | - | 2145 | WP_005740374.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..43975 | 43975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13617.77 Da Isoelectric Point: 6.0589
>T293916 WP_011106996.1 NZ_LT963403:36543-36920 [Pseudomonas syringae pv. avii]
VIGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VIGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q88BR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4U5C7 |