Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 3485..4152 | Replicon | plasmid PP1 |
Accession | NZ_LT963403 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | C6H38_RS29365 | Protein ID | WP_004642352.1 |
Coordinates | 3736..4152 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A3M5U3K4 |
Locus tag | C6H38_RS29360 | Protein ID | WP_024421297.1 |
Coordinates | 3485..3739 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS29340 | 33..842 | - | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
C6H38_RS29345 | 839..1861 | - | 1023 | WP_002551322.1 | IS21-like element ISPsy4 family transposase | - |
C6H38_RS29350 | 1905..2240 | - | 336 | WP_103388890.1 | hypothetical protein | - |
C6H38_RS29355 | 2278..3138 | - | 861 | WP_057415931.1 | MurR/RpiR family transcriptional regulator | - |
C6H38_RS29360 | 3485..3739 | + | 255 | WP_024421297.1 | plasmid stabilization protein | Antitoxin |
C6H38_RS29365 | 3736..4152 | + | 417 | WP_004642352.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
C6H38_RS29370 | 4414..6369 | - | 1956 | WP_104698131.1 | relaxase/mobilization nuclease domain-containing protein | - |
C6H38_RS29375 | 6380..6709 | - | 330 | WP_003344297.1 | ribbon-helix-helix protein, CopG family | - |
C6H38_RS29380 | 6969..7313 | + | 345 | WP_031599149.1 | hypothetical protein | - |
C6H38_RS29390 | 7611..7889 | + | 279 | WP_004661031.1 | mobilization protein | - |
C6H38_RS29395 | 7956..8156 | - | 201 | WP_004666908.1 | hypothetical protein | - |
C6H38_RS29400 | 8224..8676 | - | 453 | Protein_11 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..43975 | 43975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14797.07 Da Isoelectric Point: 4.8361
>T293915 WP_004642352.1 NZ_LT963403:3736-4152 [Pseudomonas syringae pv. avii]
MIVLDTNVVSEAMKPESHLAVRAWLNDQAAETLYLSSVTLAELLFGIGALPAGKRKDMLAQALDGLMGLFRDRVLPFDID
AARRYADLAVTAKTCGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAVGVSVINPWEV
MIVLDTNVVSEAMKPESHLAVRAWLNDQAAETLYLSSVTLAELLFGIGALPAGKRKDMLAQALDGLMGLFRDRVLPFDID
AARRYADLAVTAKTCGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAVGVSVINPWEV
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|