Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5621390..5622001 | Replicon | chromosome |
Accession | NZ_LT963402 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q4ZME8 |
Locus tag | C6H38_RS26870 | Protein ID | WP_003304103.1 |
Coordinates | 5621651..5622001 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q4ZME7 |
Locus tag | C6H38_RS26865 | Protein ID | WP_002556076.1 |
Coordinates | 5621390..5621638 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS26850 | 5616645..5617031 | - | 387 | Protein_4975 | NYN domain-containing protein | - |
C6H38_RS26855 | 5617378..5619948 | - | 2571 | WP_060413963.1 | AAA family ATPase | - |
C6H38_RS26860 | 5620093..5621055 | - | 963 | WP_060413964.1 | tyrosine-type recombinase/integrase | - |
C6H38_RS26865 | 5621390..5621638 | + | 249 | WP_002556076.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
C6H38_RS26870 | 5621651..5622001 | + | 351 | WP_003304103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H38_RS26880 | 5622653..5624038 | - | 1386 | WP_060413965.1 | P-type conjugative transfer protein TrbL | - |
C6H38_RS26885 | 5624242..5624691 | - | 450 | Protein_4981 | conjugal transfer protein TrbJ | - |
C6H38_RS26895 | 5626361..5626669 | - | 309 | Protein_4983 | conjugal transfer protein TrbJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5617378..5628507 | 11129 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12973.76 Da Isoelectric Point: 4.7690
>T293914 WP_003304103.1 NZ_LT963402:5621651-5622001 [Pseudomonas syringae pv. avii]
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GDS9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GM89 |