Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 5595524..5596563 | Replicon | chromosome |
Accession | NZ_LT963402 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | A0A2K4W0T2 |
Locus tag | C6H38_RS26725 | Protein ID | WP_060413860.1 |
Coordinates | 5595988..5596563 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A2G9KX16 |
Locus tag | C6H38_RS26720 | Protein ID | WP_005737550.1 |
Coordinates | 5595524..5595991 (+) | Length | 156 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS26695 | 5591861..5592112 | + | 252 | Protein_4946 | phosphoribulokinase | - |
C6H38_RS26700 | 5592437..5593459 | + | 1023 | WP_002551322.1 | IS21-like element ISPsy4 family transposase | - |
C6H38_RS26705 | 5593456..5594265 | + | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
C6H38_RS26710 | 5594314..5594703 | - | 390 | Protein_4949 | hypothetical protein | - |
C6H38_RS32575 | 5594749..5595249 | - | 501 | WP_060413859.1 | hypothetical protein | - |
C6H38_RS26720 | 5595524..5595991 | + | 468 | WP_005737550.1 | helix-turn-helix domain-containing protein | Antitoxin |
C6H38_RS26725 | 5595988..5596563 | + | 576 | WP_060413860.1 | PIN domain-containing protein | Toxin |
C6H38_RS26730 | 5596744..5596995 | + | 252 | WP_054089800.1 | helix-turn-helix domain-containing protein | - |
C6H38_RS26735 | 5596995..5597180 | + | 186 | Protein_4954 | HipA N-terminal domain-containing protein | - |
C6H38_RS26740 | 5597979..5598548 | + | 570 | Protein_4955 | site-specific integrase | - |
C6H38_RS26745 | 5598618..5598893 | + | 276 | WP_025168237.1 | hypothetical protein | - |
C6H38_RS26750 | 5598940..5599227 | + | 288 | WP_060413862.1 | hypothetical protein | - |
C6H38_RS26755 | 5599208..5600763 | + | 1556 | WP_103724633.1 | IS3-like element IS1240 family transposase | - |
C6H38_RS26760 | 5600837..5601400 | + | 564 | WP_060412766.1 | DUF2971 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5586993..5602703 | 15710 | |
- | inside | IScluster/Tn | - | - | 5592437..5603869 | 11432 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21958.14 Da Isoelectric Point: 5.5934
>T293913 WP_060413860.1 NZ_LT963402:5595988-5596563 [Pseudomonas syringae pv. avii]
MRHSPFTAFYDANVLYPAPLRDFLMHLALTGVYRARWSSQIHDEWKRNLLINRPELTREQLDRTSALMDKAVPDGLVSDY
QSLIEGLKLPDADDRHVLAAAIKCNASVIVTFNLKDFPKDILDTFDMEPLHPDDFIADLWDLDKAAVLEAAQRQRASLRN
PAHSARQYLDKLLQQKLPETVKLLSDFEFLI
MRHSPFTAFYDANVLYPAPLRDFLMHLALTGVYRARWSSQIHDEWKRNLLINRPELTREQLDRTSALMDKAVPDGLVSDY
QSLIEGLKLPDADDRHVLAAAIKCNASVIVTFNLKDFPKDILDTFDMEPLHPDDFIADLWDLDKAAVLEAAQRQRASLRN
PAHSARQYLDKLLQQKLPETVKLLSDFEFLI
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17233.75 Da Isoelectric Point: 5.2911
>AT293913 WP_005737550.1 NZ_LT963402:5595524-5595991 [Pseudomonas syringae pv. avii]
MSSADATRTVLPGEKEIAAAVESSRQLAAFLTTKCDTQRIELVDETQQREVVELPMFALRLLGEILSELALGNAVKVVPI
HAELTTQEAADMLNVSRPHLVKMLDQGMLPHTKTGRHRRVKFADLMSYKQQRDQASREAMDELAAQAQELGMGYE
MSSADATRTVLPGEKEIAAAVESSRQLAAFLTTKCDTQRIELVDETQQREVVELPMFALRLLGEILSELALGNAVKVVPI
HAELTTQEAADMLNVSRPHLVKMLDQGMLPHTKTGRHRRVKFADLMSYKQQRDQASREAMDELAAQAQELGMGYE
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4W0T2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G9KX16 |