Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 3913121..3913631 | Replicon | chromosome |
Accession | NZ_LT963402 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | C6H38_RS18545 | Protein ID | WP_080439383.1 |
Coordinates | 3913350..3913631 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S6UR83 |
Locus tag | C6H38_RS18540 | Protein ID | WP_005740683.1 |
Coordinates | 3913121..3913360 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS18515 | 3909296..3910081 | + | 786 | WP_060413609.1 | hypothetical protein | - |
C6H38_RS18520 | 3910208..3911116 | - | 909 | WP_054089894.1 | DUF808 domain-containing protein | - |
C6H38_RS18530 | 3911264..3911770 | - | 507 | WP_024666116.1 | winged helix-turn-helix transcriptional regulator | - |
C6H38_RS18535 | 3911936..3912952 | + | 1017 | WP_003376162.1 | 1-aminocyclopropane-1-carboxylate deaminase | - |
C6H38_RS18540 | 3913121..3913360 | + | 240 | WP_005740683.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
C6H38_RS18545 | 3913350..3913631 | + | 282 | WP_080439383.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H38_RS18550 | 3913670..3914525 | - | 856 | Protein_3447 | LysR family transcriptional regulator | - |
C6H38_RS18555 | 3914600..3915532 | + | 933 | WP_060413608.1 | DMT family transporter | - |
C6H38_RS18560 | 3915561..3917489 | - | 1929 | WP_058418816.1 | methyl-accepting chemotaxis protein | - |
C6H38_RS18565 | 3917741..3918226 | - | 486 | WP_007245243.1 | DUF2269 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10643.31 Da Isoelectric Point: 10.0884
>T293911 WP_080439383.1 NZ_LT963402:3913350-3913631 [Pseudomonas syringae pv. avii]
MQVEWLKTALKNLDDEAAYISLENPAAAVAFVEAIQISVKQLASFPALGREGRIAGTREWPLPDWPYLIPYRIRNGRLQV
LRNFHTRRQSPLV
MQVEWLKTALKNLDDEAAYISLENPAAAVAFVEAIQISVKQLASFPALGREGRIAGTREWPLPDWPYLIPYRIRNGRLQV
LRNFHTRRQSPLV
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|