Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1635685..1636307 | Replicon | chromosome |
Accession | NZ_LT963402 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q886E5 |
Locus tag | C6H38_RS07965 | Protein ID | WP_011103638.1 |
Coordinates | 1635685..1635867 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q886E4 |
Locus tag | C6H38_RS07970 | Protein ID | WP_005767619.1 |
Coordinates | 1635903..1636307 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS07955 | 1631876..1633624 | - | 1749 | WP_005767614.1 | N-acetylglutaminylglutamine synthetase | - |
C6H38_RS07960 | 1633628..1635400 | - | 1773 | WP_060411995.1 | N-acetylglutaminylglutamine amidotransferase | - |
C6H38_RS07965 | 1635685..1635867 | + | 183 | WP_011103638.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
C6H38_RS07970 | 1635903..1636307 | + | 405 | WP_005767619.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
C6H38_RS07975 | 1636323..1637402 | - | 1080 | WP_060411996.1 | iron ABC transporter permease | - |
C6H38_RS07980 | 1637392..1639869 | - | 2478 | WP_060411997.1 | ABC transporter permease | - |
C6H38_RS07985 | 1639869..1640537 | - | 669 | WP_060411998.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.81 Da Isoelectric Point: 10.6643
>T293910 WP_011103638.1 NZ_LT963402:1635685-1635867 [Pseudomonas syringae pv. avii]
VQSRQLVKELEADGWVLDRVTGSHHMFKHPEKSQTVPVPHPKKDLPLGTVKAIRKLAGLA
VQSRQLVKELEADGWVLDRVTGSHHMFKHPEKSQTVPVPHPKKDLPLGTVKAIRKLAGLA
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14455.52 Da Isoelectric Point: 4.9093
>AT293910 WP_005767619.1 NZ_LT963402:1635903-1636307 [Pseudomonas syringae pv. avii]
MKYPICIEWGDETTAFGIQIPDIPGAITAGDTFEEAHAAAVEIAHIMLQEIAASGGSIPKVGTVAEHAKNPDFSGMGWGM
LEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
MKYPICIEWGDETTAFGIQIPDIPGAITAGDTFEEAHAAAVEIAHIMLQEIAASGGSIPKVGTVAEHAKNPDFSGMGWGM
LEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q886E5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3Z2W9 |