Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 271558..272005 Replicon chromosome
Accession NZ_LT963402
Organism Pseudomonas syringae pv. avii isolate CFBP3846

Toxin (Protein)


Gene name relE Uniprot ID A0A2K4U5D1
Locus tag C6H38_RS01450 Protein ID WP_057446608.1
Coordinates 271558..271830 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M4C5H0
Locus tag C6H38_RS01455 Protein ID WP_005730485.1
Coordinates 271820..272005 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H38_RS31895 267035..267316 - 282 WP_060402147.1 hypothetical protein -
C6H38_RS01410 267522..267794 + 273 WP_060413326.1 ribbon-helix-helix domain-containing protein -
C6H38_RS01415 267794..268069 + 276 WP_060413327.1 type II toxin-antitoxin system RelE/ParE family toxin -
C6H38_RS01420 268154..268618 + 465 Protein_263 recombinase family protein -
C6H38_RS01425 268711..268989 + 279 WP_024661522.1 hypothetical protein -
C6H38_RS01430 269040..269225 + 186 WP_005730485.1 hypothetical protein -
C6H38_RS01435 269215..269487 + 273 WP_003348606.1 type II toxin-antitoxin system RelE/ParE family toxin -
C6H38_RS01440 269591..270304 + 714 WP_104698102.1 UPF0149 family protein -
C6H38_RS01445 270741..271454 - 714 WP_099264817.1 UPF0149 family protein -
C6H38_RS01450 271558..271830 - 273 WP_057446608.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H38_RS01455 271820..272005 - 186 WP_005730485.1 hypothetical protein Antitoxin
C6H38_RS01460 272056..272334 - 279 WP_024661522.1 hypothetical protein -
C6H38_RS01465 272427..272891 - 465 Protein_272 recombinase family protein -
C6H38_RS01470 272976..273251 - 276 WP_060413327.1 type II toxin-antitoxin system RelE/ParE family toxin -
C6H38_RS01475 273251..273523 - 273 WP_060413326.1 ribbon-helix-helix domain-containing protein -
C6H38_RS01480 273720..274340 + 621 WP_005747119.1 recombinase family protein -
C6H38_RS01490 274666..274887 - 222 WP_003381774.1 hypothetical protein -
C6H38_RS01495 274925..275338 - 414 WP_060402542.1 TraR/DksA family transcriptional regulator -
C6H38_RS01500 275374..275598 - 225 WP_060402543.1 carbon storage regulator -
C6H38_RS01505 275873..276850 + 978 WP_020306143.1 IS5 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10229.75 Da        Isoelectric Point: 5.0749

>T293908 WP_057446608.1 NZ_LT963402:c271830-271558 [Pseudomonas syringae pv. avii]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEAMVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIL
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7292.18 Da        Isoelectric Point: 7.2040

>AT293908 WP_005730485.1 NZ_LT963402:c272005-271820 [Pseudomonas syringae pv. avii]
MSIQLDPRVSEFETQEQADNYDRWFRQRIEHSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4U5D1

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4C5H0

References