Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 204872..205474 | Replicon | chromosome |
Accession | NZ_LT963402 | ||
Organism | Pseudomonas syringae pv. avii isolate CFBP3846 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A2K4T9S6 |
Locus tag | C6H38_RS01055 | Protein ID | WP_060413101.1 |
Coordinates | 205124..205474 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A2K4VM44 |
Locus tag | C6H38_RS01050 | Protein ID | WP_060413102.1 |
Coordinates | 204872..205111 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H38_RS01025 | 199937..200380 | - | 444 | WP_172679536.1 | ATP-dependent zinc protease | - |
C6H38_RS01030 | 200430..201212 | - | 783 | WP_024676641.1 | EAL domain-containing protein | - |
C6H38_RS01035 | 201380..201787 | + | 408 | WP_003377907.1 | RNA-binding protein S4 | - |
C6H38_RS01040 | 201948..202850 | + | 903 | WP_005613652.1 | Hsp33 family molecular chaperone HslO | - |
C6H38_RS01045 | 203030..204574 | + | 1545 | WP_060413103.1 | phosphoenolpyruvate carboxykinase | - |
C6H38_RS01050 | 204872..205111 | + | 240 | WP_060413102.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
C6H38_RS01055 | 205124..205474 | + | 351 | WP_060413101.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H38_RS01060 | 205777..206229 | - | 453 | WP_060413100.1 | hypothetical protein | - |
C6H38_RS01065 | 206608..207222 | - | 615 | WP_060413099.1 | hypothetical protein | - |
C6H38_RS01070 | 207319..208026 | - | 708 | WP_060413098.1 | hypothetical protein | - |
C6H38_RS01075 | 208155..208603 | - | 449 | Protein_202 | hypothetical protein | - |
C6H38_RS01080 | 209052..209765 | - | 714 | WP_060413097.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13124.08 Da Isoelectric Point: 4.3176
>T293905 WP_060413101.1 NZ_LT963402:205124-205474 [Pseudomonas syringae pv. avii]
MNMFALRFTDVAQQSLEDQVEHLAVYQGFSPAAQRIDTLIDAIQDKLLSTPLAYPVSPQLSELGVLHYRELNADGYRIFY
EVRETDDINVIVIVLVLGGKQSVEQALIRYCLLQPI
MNMFALRFTDVAQQSLEDQVEHLAVYQGFSPAAQRIDTLIDAIQDKLLSTPLAYPVSPQLSELGVLHYRELNADGYRIFY
EVRETDDINVIVIVLVLGGKQSVEQALIRYCLLQPI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4T9S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4VM44 |