Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RHH
Location 9165..9712 Replicon plasmid PP6
Accession NZ_LT963401
Organism Pseudomonas cerasi isolate PL963

Toxin (Protein)


Gene name relE Uniprot ID A0A193SHA4
Locus tag C6H34_RS30150 Protein ID WP_057425920.1
Coordinates 9437..9712 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H1ZWV1
Locus tag C6H34_RS30145 Protein ID WP_015060662.1
Coordinates 9165..9437 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H34_RS30115 4274..6304 + 2031 WP_065348591.1 hypothetical protein -
C6H34_RS30120 6863..7027 + 165 Protein_6 IS5/IS1182 family transposase -
C6H34_RS30125 7025..7213 - 189 Protein_7 DUF4158 domain-containing protein -
C6H34_RS30130 7217..7777 - 561 WP_065348730.1 recombinase family protein -
C6H34_RS30135 7886..8317 - 432 WP_065348729.1 DUF1198 family protein -
C6H34_RS30140 8400..8918 - 519 WP_083188299.1 GNAT family N-acetyltransferase -
C6H34_RS30145 9165..9437 + 273 WP_015060662.1 ribbon-helix-helix domain-containing protein Antitoxin
C6H34_RS30150 9437..9712 + 276 WP_057425920.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H34_RS30155 9796..10032 + 237 Protein_13 recombinase family protein -
C6H34_RS30160 10128..10400 + 273 WP_065348728.1 arylsulfatase regulator -
C6H34_RS30165 10613..11287 + 675 WP_080269136.1 MobA/MobL family protein -
C6H34_RS30170 11284..11811 - 528 WP_003348567.1 hypothetical protein -
C6H34_RS30175 11979..13001 + 1023 WP_002551322.1 IS21-like element ISPsy4 family transposase -
C6H34_RS30180 12998..13792 + 795 Protein_18 IS21-like element helper ATPase IstB -
C6H34_RS30185 13926..14219 - 294 WP_003348565.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..18360 18360
- inside IScluster/Tn - - 7217..13537 6320


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(10-47)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10737.30 Da        Isoelectric Point: 7.0126

>T293903 WP_057425920.1 NZ_LT963401:9437-9712 [Pseudomonas cerasi]
MELKWTSKALSDITRLYEFLALANQPAAARVVQQLTTAPTTLLTNPRIGERLEEFEPKDVRRIQIGQYEMRYEVADSTIY
LLRLWHTREDR

Download         Length: 276 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10076.40 Da        Isoelectric Point: 5.6994

>AT293903 WP_015060662.1 NZ_LT963401:9165-9437 [Pseudomonas cerasi]
MATTAKTRSVTAHVPVQLAEKVDLMAERLERSKNWIVKQALSAWIDQEEERSRLTREALADVDAGRVIDHQAVQAWADSL
STDTPLPVPR

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SHA4

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4CJB9

References