Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 11126..11706 Replicon plasmid PP5
Accession NZ_LT963400
Organism Pseudomonas cerasi isolate PL963

Toxin (Protein)


Gene name PumA Uniprot ID A0A2G4CV40
Locus tag C6H34_RS29830 Protein ID WP_044322659.1
Coordinates 11407..11706 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID A0A2G4CUT8
Locus tag C6H34_RS29825 Protein ID WP_003407168.1
Coordinates 11126..11410 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H34_RS29800 6599..6820 + 222 WP_004666801.1 hypothetical protein -
C6H34_RS29805 7384..8402 - 1019 Protein_6 tyrosine protein phosphatase -
C6H34_RS29810 8630..9652 + 1023 WP_002551322.1 IS21-like element ISPsy4 family transposase -
C6H34_RS29815 9649..10458 + 810 WP_005741073.1 IS21-like element ISPsy4 family helper ATPase IstB -
C6H34_RS29820 10743..11051 + 309 WP_181135240.1 DUF4113 domain-containing protein -
C6H34_RS29825 11126..11410 - 285 WP_003407168.1 putative addiction module antidote protein Antitoxin
C6H34_RS29830 11407..11706 - 300 WP_044322659.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H34_RS29840 12216..12632 + 417 WP_044322716.1 hypothetical protein -
C6H34_RS30910 12641..12874 - 234 WP_134931282.1 hypothetical protein -
C6H34_RS29850 13028..13681 + 654 WP_044322644.1 AAA family ATPase -
C6H34_RS29855 13770..14021 + 252 WP_003348789.1 ribbon-helix-helix protein, CopG family -
C6H34_RS29860 14285..14902 + 618 WP_065348578.1 SOS response-associated peptidase -
C6H34_RS29865 15093..15771 + 679 Protein_17 tyrosine-type recombinase/integrase -
C6H34_RS29870 15834..16643 - 810 WP_005741073.1 IS21-like element ISPsy4 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..48121 48121


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-95)

Antitoxin

Uncharacterized protein HI1420

(10-92)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11170.80 Da        Isoelectric Point: 9.9231

>T293902 WP_044322659.1 NZ_LT963400:c11706-11407 [Pseudomonas cerasi]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE

Download         Length: 300 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10277.83 Da        Isoelectric Point: 5.0916

>AT293902 WP_003407168.1 NZ_LT963400:c11410-11126 [Pseudomonas cerasi]
MKEQIFDYDPAAALDGPEAIAIFISDAFETGDAEYIAKAMGVVARAKGMTELARETGLSREQLYRSFSSKGNPTLKTMLT
VMRALGVDMTARMH

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2G4CV40

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4CUT8

References