Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 11126..11706 | Replicon | plasmid PP5 |
Accession | NZ_LT963400 | ||
Organism | Pseudomonas cerasi isolate PL963 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A2G4CV40 |
Locus tag | C6H34_RS29830 | Protein ID | WP_044322659.1 |
Coordinates | 11407..11706 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A2G4CUT8 |
Locus tag | C6H34_RS29825 | Protein ID | WP_003407168.1 |
Coordinates | 11126..11410 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H34_RS29800 | 6599..6820 | + | 222 | WP_004666801.1 | hypothetical protein | - |
C6H34_RS29805 | 7384..8402 | - | 1019 | Protein_6 | tyrosine protein phosphatase | - |
C6H34_RS29810 | 8630..9652 | + | 1023 | WP_002551322.1 | IS21-like element ISPsy4 family transposase | - |
C6H34_RS29815 | 9649..10458 | + | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
C6H34_RS29820 | 10743..11051 | + | 309 | WP_181135240.1 | DUF4113 domain-containing protein | - |
C6H34_RS29825 | 11126..11410 | - | 285 | WP_003407168.1 | putative addiction module antidote protein | Antitoxin |
C6H34_RS29830 | 11407..11706 | - | 300 | WP_044322659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H34_RS29840 | 12216..12632 | + | 417 | WP_044322716.1 | hypothetical protein | - |
C6H34_RS30910 | 12641..12874 | - | 234 | WP_134931282.1 | hypothetical protein | - |
C6H34_RS29850 | 13028..13681 | + | 654 | WP_044322644.1 | AAA family ATPase | - |
C6H34_RS29855 | 13770..14021 | + | 252 | WP_003348789.1 | ribbon-helix-helix protein, CopG family | - |
C6H34_RS29860 | 14285..14902 | + | 618 | WP_065348578.1 | SOS response-associated peptidase | - |
C6H34_RS29865 | 15093..15771 | + | 679 | Protein_17 | tyrosine-type recombinase/integrase | - |
C6H34_RS29870 | 15834..16643 | - | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..48121 | 48121 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11170.80 Da Isoelectric Point: 9.9231
>T293902 WP_044322659.1 NZ_LT963400:c11706-11407 [Pseudomonas cerasi]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4CV40 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4CUT8 |