Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
| Location | 28522..29096 | Replicon | plasmid PP3 |
| Accession | NZ_LT963398 | ||
| Organism | Pseudomonas cerasi isolate PL963 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A193SFU9 |
| Locus tag | C6H34_RS28990 | Protein ID | WP_065348555.1 |
| Coordinates | 28719..29096 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8B3GLI3 |
| Locus tag | C6H34_RS28985 | Protein ID | WP_020309477.1 |
| Coordinates | 28522..28722 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H34_RS30890 | 23553..23717 | - | 165 | WP_004666862.1 | hypothetical protein | - |
| C6H34_RS28965 | 23873..24538 | - | 666 | WP_065348558.1 | type III effector AvrRps4 | - |
| C6H34_RS28975 | 25151..27358 | - | 2208 | WP_065348557.1 | type IV secretory system conjugative DNA transfer family protein | - |
| C6H34_RS28980 | 27345..28430 | - | 1086 | WP_065348556.1 | thioredoxin fold domain-containing protein | - |
| C6H34_RS28985 | 28522..28722 | + | 201 | WP_020309477.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| C6H34_RS28990 | 28719..29096 | + | 378 | WP_065348555.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| C6H34_RS28995 | 29086..30288 | - | 1203 | WP_020325421.1 | hypothetical protein | - |
| C6H34_RS29000 | 30380..31030 | - | 651 | WP_065348554.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| C6H34_RS29005 | 31027..31272 | - | 246 | WP_003344389.1 | hypothetical protein | - |
| C6H34_RS29010 | 31375..33519 | - | 2145 | WP_065348553.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..81323 | 81323 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13646.81 Da Isoelectric Point: 6.4728
>T293900 WP_065348555.1 NZ_LT963398:28719-29096 [Pseudomonas cerasi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVEMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVEMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A193SFU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B3GLI3 |