Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 28522..29096 Replicon plasmid PP3
Accession NZ_LT963398
Organism Pseudomonas cerasi isolate PL963

Toxin (Protein)


Gene name vapC Uniprot ID A0A193SFU9
Locus tag C6H34_RS28990 Protein ID WP_065348555.1
Coordinates 28719..29096 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8B3GLI3
Locus tag C6H34_RS28985 Protein ID WP_020309477.1
Coordinates 28522..28722 (+) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H34_RS30890 23553..23717 - 165 WP_004666862.1 hypothetical protein -
C6H34_RS28965 23873..24538 - 666 WP_065348558.1 type III effector AvrRps4 -
C6H34_RS28975 25151..27358 - 2208 WP_065348557.1 type IV secretory system conjugative DNA transfer family protein -
C6H34_RS28980 27345..28430 - 1086 WP_065348556.1 thioredoxin fold domain-containing protein -
C6H34_RS28985 28522..28722 + 201 WP_020309477.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
C6H34_RS28990 28719..29096 + 378 WP_065348555.1 type II toxin-antitoxin system VapC family toxin Toxin
C6H34_RS28995 29086..30288 - 1203 WP_020325421.1 hypothetical protein -
C6H34_RS29000 30380..31030 - 651 WP_065348554.1 plasmid IncI1-type surface exclusion protein ExcA -
C6H34_RS29005 31027..31272 - 246 WP_003344389.1 hypothetical protein -
C6H34_RS29010 31375..33519 - 2145 WP_065348553.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..81323 81323


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-43)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13646.81 Da        Isoelectric Point: 6.4728

>T293900 WP_065348555.1 NZ_LT963398:28719-29096 [Pseudomonas cerasi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVEMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH

Download         Length: 378 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7415.64 Da        Isoelectric Point: 7.0102

>AT293900 WP_020309477.1 NZ_LT963398:28522-28722 [Pseudomonas cerasi]
MRTTVTIDDALYQRALEVADPAMDKADLFREAVQTFVRIQAAKRLMALGATLPAMEDIARRHEKAL

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SFU9

Antitoxin

Source ID Structure
AlphaFold DB A0A8B3GLI3

References