Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
Location | 10052..10663 | Replicon | plasmid PP3 |
Accession | NZ_LT963398 | ||
Organism | Pseudomonas cerasi isolate PL963 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A193SFX2 |
Locus tag | C6H34_RS28890 | Protein ID | WP_065348564.1 |
Coordinates | 10313..10663 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q6VE98 |
Locus tag | C6H34_RS28885 | Protein ID | WP_011152898.1 |
Coordinates | 10052..10300 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H34_RS28865 | 5096..6670 | - | 1575 | WP_065348574.1 | diguanylate cyclase | - |
C6H34_RS28870 | 7109..7894 | - | 786 | Protein_11 | methyl-accepting chemotaxis protein | - |
C6H34_RS28875 | 8418..8732 | + | 315 | WP_065348583.1 | hypothetical protein | - |
C6H34_RS28880 | 8758..9720 | - | 963 | WP_065348573.1 | tyrosine-type recombinase/integrase | - |
C6H34_RS28885 | 10052..10300 | + | 249 | WP_011152898.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C6H34_RS28890 | 10313..10663 | + | 351 | WP_065348564.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H34_RS28895 | 10770..11174 | - | 405 | WP_065348582.1 | DUF4279 domain-containing protein | - |
C6H34_RS30885 | 11372..11779 | - | 408 | WP_065348563.1 | hypothetical protein | - |
C6H34_RS28900 | 11776..14541 | - | 2766 | WP_065348562.1 | RHS repeat-associated core domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81323 | 81323 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12947.79 Da Isoelectric Point: 4.1953
>T293899 WP_065348564.1 NZ_LT963398:10313-10663 [Pseudomonas cerasi]
MNTFALRFTEVAQQSIEDQVEHLAITQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
MNTFALRFTEVAQQSIEDQVEHLAITQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A193SFX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8LY57 |