Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 30543..31216 | Replicon | plasmid PP2 |
Accession | NZ_LT963397 | ||
Organism | Pseudomonas cerasi isolate PL963 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2K4W2P1 |
Locus tag | C6H34_RS28195 | Protein ID | WP_060402639.1 |
Coordinates | 30797..31216 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q48B52 |
Locus tag | C6H34_RS28190 | Protein ID | WP_003381346.1 |
Coordinates | 30543..30800 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H34_RS28160 | 27404..27769 | - | 366 | Protein_29 | MobA/MobL family protein | - |
C6H34_RS28165 | 27808..28080 | - | 273 | WP_015060672.1 | hypothetical protein | - |
C6H34_RS30835 | 28234..28491 | + | 258 | WP_157893878.1 | hypothetical protein | - |
C6H34_RS28175 | 28799..29080 | + | 282 | WP_060402791.1 | hypothetical protein | - |
C6H34_RS28180 | 29061..30290 | + | 1230 | WP_065348575.1 | IS91 family transposase | - |
C6H34_RS28190 | 30543..30800 | + | 258 | WP_003381346.1 | Arc family DNA-binding protein | Antitoxin |
C6H34_RS28195 | 30797..31216 | + | 420 | WP_060402639.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
C6H34_RS28200 | 31257..31889 | + | 633 | WP_103750722.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..144075 | 144075 | |
- | flank | IS/Tn | - | - | 29082..30290 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15164.46 Da Isoelectric Point: 4.5482
>T293898 WP_060402639.1 NZ_LT963397:30797-31216 [Pseudomonas cerasi]
MILLDTNVISEPQRREPNAHVLDWIDAQALETLYLSTITVAELRAGIALMPVGKRQDSLRENLEKYLLPMFANRVLSFDM
TCTKAYAELLAKSRAAGLAVETADAFIAAIALANGFTVATRDTGPFEAAGLNVINPWEA
MILLDTNVISEPQRREPNAHVLDWIDAQALETLYLSTITVAELRAGIALMPVGKRQDSLRENLEKYLLPMFANRVLSFDM
TCTKAYAELLAKSRAAGLAVETADAFIAAIALANGFTVATRDTGPFEAAGLNVINPWEA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K4W2P1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q48B52 |