Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4195752..4196374 | Replicon | chromosome |
Accession | NZ_LT963395 | ||
Organism | Pseudomonas cerasi isolate PL963 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A658PBH1 |
Locus tag | C6H34_RS19410 | Protein ID | WP_003434313.1 |
Coordinates | 4196192..4196374 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A193SSY5 |
Locus tag | C6H34_RS19405 | Protein ID | WP_024661723.1 |
Coordinates | 4195752..4196156 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H34_RS19390 | 4191518..4192186 | + | 669 | WP_065350359.1 | ABC transporter ATP-binding protein | - |
C6H34_RS19395 | 4192186..4194666 | + | 2481 | WP_065350360.1 | ABC transporter permease | - |
C6H34_RS19400 | 4194656..4195735 | + | 1080 | WP_065350361.1 | iron ABC transporter permease | - |
C6H34_RS19405 | 4195752..4196156 | - | 405 | WP_024661723.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
C6H34_RS19410 | 4196192..4196374 | - | 183 | WP_003434313.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
C6H34_RS19415 | 4196658..4198430 | + | 1773 | WP_024661722.1 | N-acetylglutaminylglutamine amidotransferase | - |
C6H34_RS19420 | 4198434..4200182 | + | 1749 | WP_024661721.1 | N-acetylglutaminylglutamine synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6777.99 Da Isoelectric Point: 10.6643
>T293897 WP_003434313.1 NZ_LT963395:c4196374-4196192 [Pseudomonas cerasi]
VQSRQLIKELEADGWILDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
VQSRQLIKELEADGWILDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14345.43 Da Isoelectric Point: 5.1643
>AT293897 WP_024661723.1 NZ_LT963395:c4196156-4195752 [Pseudomonas cerasi]
MKYPMCIEWGSETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAAGGGTIPKAGTVAEHARNADFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIKQIDRYVRDHSIKSRSTFLADAALEKLGRA
MKYPMCIEWGSETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAAGGGTIPKAGTVAEHARNADFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIKQIDRYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A658PBH1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A193SSY5 |