Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 462326..462960 Replicon chromosome
Accession NZ_LT963395
Organism Pseudomonas cerasi isolate PL963

Toxin (Protein)


Gene name vapC Uniprot ID A0A193SM35
Locus tag C6H34_RS02225 Protein ID WP_003345997.1
Coordinates 462556..462960 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A193SK58
Locus tag C6H34_RS02220 Protein ID WP_065349081.1
Coordinates 462326..462556 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H34_RS02195 457400..458425 + 1026 WP_024693616.1 TRAP transporter substrate-binding protein -
C6H34_RS02200 458489..459016 + 528 WP_003408544.1 TRAP transporter small permease -
C6H34_RS02205 459017..460297 + 1281 WP_065349083.1 TRAP transporter large permease -
C6H34_RS02210 460382..461353 + 972 WP_024649225.1 DMT family transporter -
C6H34_RS02215 461328..462209 + 882 WP_104685592.1 aldose 1-epimerase -
C6H34_RS02220 462326..462556 + 231 WP_065349081.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
C6H34_RS02225 462556..462960 + 405 WP_003345997.1 tRNA(fMet)-specific endonuclease VapC Toxin
C6H34_RS02230 463147..463722 - 576 WP_024663312.1 hypothetical protein -
C6H34_RS02235 463721..463909 + 189 WP_024663313.1 hypothetical protein -
C6H34_RS02240 464145..464657 + 513 WP_024663314.1 sigma-70 family RNA polymerase sigma factor -
C6H34_RS02245 464657..465319 + 663 WP_003421647.1 ChrR family anti-sigma-E factor -
C6H34_RS02250 465342..466598 - 1257 WP_004402530.1 3-phosphoshikimate 1-carboxyvinyltransferase -
C6H34_RS02255 466695..467177 - 483 WP_003345989.1 PAS domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(7-34)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14946.21 Da        Isoelectric Point: 6.8620

>T293896 WP_003345997.1 NZ_LT963395:462556-462960 [Pseudomonas cerasi]
MLKYMLDTNICIFTIKNKPTSVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARSGTPIGPYDQMIAGHARSLGLVVITNNQREFRRVEGLRVEDWVSQ

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8579.60 Da        Isoelectric Point: 4.7405

>AT293896 WP_065349081.1 NZ_LT963395:462326-462556 [Pseudomonas cerasi]
MEQSTVFKSNRSQAVRLPKAVALPNDVKRVDVVAVGRTRIISPAGEMWNSWFDGESVSDDFMAEREQPAEQQRESL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SM35

Antitoxin

Source ID Structure
AlphaFold DB A0A193SK58

References