Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 105510..105960 Replicon plasmid PP3
Accession NZ_LT963394
Organism Pseudomonas syringae pv. cerasicola isolate CFBP6109

Toxin (Protein)


Gene name relE Uniprot ID A0A7V8S1Y9
Locus tag C6H44_RS30510 Protein ID WP_004666886.1
Coordinates 105510..105779 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M5MG95
Locus tag C6H44_RS30515 Protein ID WP_004666885.1
Coordinates 105769..105960 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H44_RS30480 100563..101270 + 708 WP_004661192.1 DotI/IcmL/TraM family protein -
C6H44_RS30485 101327..102382 + 1056 WP_080437690.1 conjugal transfer protein TraN -
C6H44_RS30490 102388..103746 + 1359 WP_057458873.1 conjugal transfer protein TraO -
C6H44_RS30495 103743..104453 + 711 WP_057458872.1 conjugal transfer protein TraP -
C6H44_RS30500 104462..105004 + 543 WP_054073046.1 conjugal transfer protein TraQ -
C6H44_RS30505 105080..105466 + 387 WP_057458871.1 hypothetical protein -
C6H44_RS30510 105510..105779 - 270 WP_004666886.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H44_RS30515 105769..105960 - 192 WP_004666885.1 hypothetical protein Antitoxin
C6H44_RS30520 106145..106804 + 660 WP_057421806.1 hypothetical protein -
C6H44_RS30525 106779..109826 + 3048 WP_060411275.1 conjugal transfer protein -
C6H44_RS30530 109849..110085 + 237 WP_060411276.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..111777 111777


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10498.00 Da        Isoelectric Point: 6.7216

>T293895 WP_004666886.1 NZ_LT963394:c105779-105510 [Pseudomonas syringae pv. cerasicola]
MLVEWRPEARAELWSILNYITDQNPMAAERLNQTIEASTTALPQHPYLYRLGQVYGTREMVVHPNYVVVYRVTDRIEIVN
VLHARQQYP

Download         Length: 270 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7260.07 Da        Isoelectric Point: 5.6233

>AT293895 WP_004666885.1 NZ_LT963394:c105960-105769 [Pseudomonas syringae pv. cerasicola]
MSTQLSPIVSEFETQEQADSYDRWFRAKVQASLDDPRPNIPHDQVMSEMRALIESKKNKHNAG

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7V8S1Y9

Antitoxin

Source ID Structure
AlphaFold DB A0A3M5MG95

References