Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 4610..5184 Replicon plasmid PP3
Accession NZ_LT963394
Organism Pseudomonas syringae pv. cerasicola isolate CFBP6109

Toxin (Protein)


Gene name vapC Uniprot ID Q48BC5
Locus tag C6H44_RS29945 Protein ID WP_003344395.1
Coordinates 4610..4987 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8B3GLI3
Locus tag C6H44_RS29950 Protein ID WP_020309477.1
Coordinates 4984..5184 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H44_RS29925 186..2330 + 2145 WP_060411279.1 DotA/TraY family protein -
C6H44_RS29930 2433..2678 + 246 WP_003344389.1 hypothetical protein -
C6H44_RS29935 2675..3325 + 651 WP_054998685.1 plasmid IncI1-type surface exclusion protein ExcA -
C6H44_RS29940 3418..4620 + 1203 WP_060411280.1 hypothetical protein -
C6H44_RS29945 4610..4987 - 378 WP_003344395.1 PIN domain-containing protein Toxin
C6H44_RS29950 4984..5184 - 201 WP_020309477.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
C6H44_RS29955 5277..6362 + 1086 WP_060411281.1 thioredoxin fold domain-containing protein -
C6H44_RS29960 6349..8637 + 2289 WP_060411282.1 type IV secretory system conjugative DNA transfer family protein -
C6H44_RS29970 9075..9503 + 429 WP_060411283.1 GntR family transcriptional regulator -
C6H44_RS29975 9723..9920 + 198 WP_010209245.1 ribbon-helix-helix protein, CopG family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..111777 111777


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-113)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-43)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13633.73 Da        Isoelectric Point: 6.4723

>T293894 WP_003344395.1 NZ_LT963394:c4987-4610 [Pseudomonas syringae pv. cerasicola]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH

Download         Length: 378 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7415.64 Da        Isoelectric Point: 7.0102

>AT293894 WP_020309477.1 NZ_LT963394:c5184-4984 [Pseudomonas syringae pv. cerasicola]
MRTTVTIDDALYQRALEVADPAMDKADLFREAVQTFVRIQAAKRLMALGATLPAMEDIARRHEKAL

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B3GPE2

Antitoxin

Source ID Structure
AlphaFold DB A0A8B3GLI3

References