Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 4610..5184 | Replicon | plasmid PP3 |
Accession | NZ_LT963394 | ||
Organism | Pseudomonas syringae pv. cerasicola isolate CFBP6109 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q48BC5 |
Locus tag | C6H44_RS29945 | Protein ID | WP_003344395.1 |
Coordinates | 4610..4987 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8B3GLI3 |
Locus tag | C6H44_RS29950 | Protein ID | WP_020309477.1 |
Coordinates | 4984..5184 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H44_RS29925 | 186..2330 | + | 2145 | WP_060411279.1 | DotA/TraY family protein | - |
C6H44_RS29930 | 2433..2678 | + | 246 | WP_003344389.1 | hypothetical protein | - |
C6H44_RS29935 | 2675..3325 | + | 651 | WP_054998685.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
C6H44_RS29940 | 3418..4620 | + | 1203 | WP_060411280.1 | hypothetical protein | - |
C6H44_RS29945 | 4610..4987 | - | 378 | WP_003344395.1 | PIN domain-containing protein | Toxin |
C6H44_RS29950 | 4984..5184 | - | 201 | WP_020309477.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
C6H44_RS29955 | 5277..6362 | + | 1086 | WP_060411281.1 | thioredoxin fold domain-containing protein | - |
C6H44_RS29960 | 6349..8637 | + | 2289 | WP_060411282.1 | type IV secretory system conjugative DNA transfer family protein | - |
C6H44_RS29970 | 9075..9503 | + | 429 | WP_060411283.1 | GntR family transcriptional regulator | - |
C6H44_RS29975 | 9723..9920 | + | 198 | WP_010209245.1 | ribbon-helix-helix protein, CopG family | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..111777 | 111777 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13633.73 Da Isoelectric Point: 6.4723
>T293894 WP_003344395.1 NZ_LT963394:c4987-4610 [Pseudomonas syringae pv. cerasicola]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B3GPE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B3GLI3 |