Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 71755..72224 Replicon plasmid PP2
Accession NZ_LT963393
Organism Pseudomonas syringae pv. cerasicola isolate CFBP6109

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag C6H44_RS29830 Protein ID WP_044322491.1
Coordinates 71755..72036 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q48BA1
Locus tag C6H44_RS29835 Protein ID WP_002556028.1
Coordinates 72036..72224 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H44_RS29780 67052..67672 - 621 WP_005747119.1 recombinase family protein -
C6H44_RS29785 67908..68246 + 339 WP_054071658.1 type II toxin-antitoxin system RelE/ParE family toxin -
C6H44_RS29790 68246..68533 + 288 WP_005622028.1 helix-turn-helix domain-containing protein -
C6H44_RS29795 68595..69011 + 417 WP_057458731.1 hypothetical protein -
C6H44_RS29805 69471..69820 + 350 Protein_72 hypothetical protein -
C6H44_RS29810 69867..70717 + 851 Protein_73 DUF945 domain-containing protein -
C6H44_RS29815 70775..70963 + 189 WP_007247499.1 hypothetical protein -
C6H44_RS29820 71038..71316 - 279 WP_057458732.1 mobilization protein -
C6H44_RS29830 71755..72036 - 282 WP_044322491.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
C6H44_RS29835 72036..72224 - 189 WP_002556028.1 hypothetical protein Antitoxin
C6H44_RS29840 72401..73039 - 639 WP_060411316.1 recombinase family protein -
C6H44_RS29850 74504..75481 + 978 WP_032701292.1 IS5 family transposase -
C6H44_RS29855 75850..76131 + 282 WP_019742102.1 DUF1778 domain-containing protein -
C6H44_RS29860 76128..76637 + 510 WP_054088148.1 GNAT family N-acetyltransferase -
C6H44_RS29865 76667..76897 - 231 WP_019742104.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..86328 86328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-85)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10676.29 Da        Isoelectric Point: 6.7242

>T293893 WP_044322491.1 NZ_LT963393:c72036-71755 [Pseudomonas syringae pv. cerasicola]
MLPVVWLSPALDDLREIATYIAWENPSAARRLKSLLQEAIEPVAEHPYLYRSGRAPGTRELVAHPNYVLVYRVTLERIEV
VNVIHARQEYPSP

Download         Length: 282 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 7043.86 Da        Isoelectric Point: 4.2550

>AT293893 WP_002556028.1 NZ_LT963393:c72224-72036 [Pseudomonas syringae pv. cerasicola]
MANLSPIVSEFETDEQAASYDRWFRAKVAASLADPRPAIPHDEVMAEIEALIDQVETQREKR

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2G9KWB9

References