Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 4228758..4229293 | Replicon | chromosome |
Accession | NZ_LT962688 | ||
Organism | Methylorubrum extorquens strain TK 0001 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | TK0001_RS19940 | Protein ID | WP_056507173.1 |
Coordinates | 4228758..4229048 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | TK0001_RS19945 | Protein ID | WP_056507176.1 |
Coordinates | 4229045..4229293 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TK0001_RS19910 | 4224064..4224264 | + | 201 | WP_003605412.1 | hypothetical protein | - |
TK0001_RS19915 | 4224487..4225111 | + | 625 | Protein_3938 | TetR family transcriptional regulator | - |
TK0001_RS19920 | 4225131..4225475 | - | 345 | WP_003605408.1 | DUF1330 domain-containing protein | - |
TK0001_RS19925 | 4225478..4226177 | - | 700 | Protein_3940 | orotidine-5'-phosphate decarboxylase | - |
TK0001_RS19930 | 4226502..4228029 | + | 1528 | Protein_3941 | alginate export family protein | - |
TK0001_RS19935 | 4228037..4228676 | - | 640 | Protein_3942 | uracil-DNA glycosylase family protein | - |
TK0001_RS19940 | 4228758..4229048 | - | 291 | WP_056507173.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
TK0001_RS19945 | 4229045..4229293 | - | 249 | WP_056507176.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
TK0001_RS19950 | 4229427..4230929 | + | 1503 | WP_101476146.1 | glucose-6-phosphate dehydrogenase | - |
TK0001_RS19955 | 4231125..4232492 | + | 1368 | WP_056507183.1 | SWIM zinc finger family protein | - |
TK0001_RS19960 | 4232492..4234075 | + | 1584 | WP_056507185.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11025.59 Da Isoelectric Point: 10.5105
>T293867 WP_056507173.1 NZ_LT962688:c4229048-4228758 [Methylorubrum extorquens]
MSVRLSPRARADLSRIWDDSAERWGADQADRYIRLLAGGFDRLAEDPARGLRADEIRKGYFRLSVGSHVLFYRLGAEGGI
EVIRILHGRMDFKRHL
MSVRLSPRARADLSRIWDDSAERWGADQADRYIRLLAGGFDRLAEDPARGLRADEIRKGYFRLSVGSHVLFYRLGAEGGI
EVIRILHGRMDFKRHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|