Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 1472581..1473112 | Replicon | chromosome |
Accession | NZ_LT962688 | ||
Organism | Methylorubrum extorquens strain TK 0001 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | TK0001_RS06915 | Protein ID | WP_003605878.1 |
Coordinates | 1472581..1472862 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | C5B2A4 |
Locus tag | TK0001_RS06920 | Protein ID | WP_003605879.1 |
Coordinates | 1472849..1473112 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TK0001_RS06890 | 1469159..1469989 | + | 831 | WP_101475551.1 | nucleoside triphosphate pyrophosphohydrolase | - |
TK0001_RS06895 | 1470127..1470318 | - | 192 | WP_056501144.1 | hypothetical protein | - |
TK0001_RS06900 | 1470407..1470829 | - | 423 | WP_101475552.1 | DoxX family protein | - |
TK0001_RS06905 | 1470836..1471021 | - | 186 | WP_003605874.1 | hypothetical protein | - |
TK0001_RS06910 | 1471118..1472464 | - | 1347 | WP_056501131.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
TK0001_RS06915 | 1472581..1472862 | - | 282 | WP_003605878.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
TK0001_RS06920 | 1472849..1473112 | - | 264 | WP_003605879.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
TK0001_RS06925 | 1473405..1474805 | + | 1401 | WP_056501127.1 | aminodeoxychorismate synthase component I | - |
TK0001_RS06930 | 1474802..1475431 | + | 630 | WP_056501123.1 | aminodeoxychorismate/anthranilate synthase component II | - |
TK0001_RS06935 | 1475418..1476275 | + | 858 | WP_101475553.1 | aminotransferase class IV | - |
TK0001_RS06940 | 1476445..1477071 | - | 627 | WP_056153177.1 | bifunctional nicotinamidase/pyrazinamidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10664.24 Da Isoelectric Point: 10.2159
>T293864 WP_003605878.1 NZ_LT962688:c1472862-1472581 [Methylorubrum extorquens]
MRTIERTTQFKRDYKREMKGRHRASLQADLTAVLTELAADRPLAARLRDHALTGNWADHRDCHVKPDLVLIYRLAGTETL
QLVRLGSHAELGF
MRTIERTTQFKRDYKREMKGRHRASLQADLTAVLTELAADRPLAARLRDHALTGNWADHRDCHVKPDLVLIYRLAGTETL
QLVRLGSHAELGF
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|