Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 6008679..6009226 | Replicon | chromosome |
Accession | NZ_LT962481 | ||
Organism | Pseudomonas syringae pv. syringae isolate CFBP2118 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0L8IUR7 |
Locus tag | C6H33_RS27255 | Protein ID | WP_003401398.1 |
Coordinates | 6008679..6008954 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0L8IV93 |
Locus tag | C6H33_RS27260 | Protein ID | WP_003401400.1 |
Coordinates | 6008954..6009226 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H33_RS27230 | 6003953..6004948 | + | 996 | WP_011269432.1 | NAD-dependent epimerase | - |
C6H33_RS27235 | 6004960..6005703 | + | 744 | WP_024640371.1 | glycosyltransferase family 2 protein | - |
C6H33_RS27240 | 6005700..6005984 | + | 285 | WP_003367870.1 | lipid-A-disaccharide synthase N-terminal domain-containing protein | - |
C6H33_RS27245 | 6005981..6007510 | + | 1530 | WP_096126716.1 | glycosyltransferase family 39 protein | - |
C6H33_RS27250 | 6007552..6008532 | + | 981 | WP_104724337.1 | SdiA-regulated domain-containing protein | - |
C6H33_RS27255 | 6008679..6008954 | - | 276 | WP_003401398.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C6H33_RS27260 | 6008954..6009226 | - | 273 | WP_003401400.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
C6H33_RS27265 | 6009426..6010151 | + | 726 | WP_024640368.1 | NAD(P)-dependent oxidoreductase | - |
C6H33_RS27270 | 6010258..6012093 | - | 1836 | WP_104724339.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
C6H33_RS27275 | 6012103..6012870 | - | 768 | WP_010422861.1 | DeoR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10774.29 Da Isoelectric Point: 9.5559
>T293862 WP_003401398.1 NZ_LT962481:c6008954-6008679 [Pseudomonas syringae pv. syringae]
MELKWTSKALSDIARLYEFLAAVNQPAAARTVQQLTSAPTTLRTNPRIGERLEEFEPRDVRRIQIGHYEMRYEIVNSTVY
LLRLWHSREDR
MELKWTSKALSDIARLYEFLAAVNQPAAARTVQQLTSAPTTLRTNPRIGERLEEFEPRDVRRIQIGHYEMRYEIVNSTVY
LLRLWHSREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L8IUR7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L8IV93 |