Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 1549775..1550300 | Replicon | chromosome |
| Accession | NZ_LT962481 | ||
| Organism | Pseudomonas syringae pv. syringae isolate CFBP2118 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | Q4ZPQ9 |
| Locus tag | C6H33_RS07440 | Protein ID | WP_011268681.1 |
| Coordinates | 1549775..1550065 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q4ZPR0 |
| Locus tag | C6H33_RS07445 | Protein ID | WP_003402372.1 |
| Coordinates | 1550055..1550300 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6H33_RS07415 | 1544883..1545353 | - | 471 | WP_104723213.1 | MaoC family dehydratase | - |
| C6H33_RS07425 | 1545722..1547410 | + | 1689 | WP_058398949.1 | long-chain-fatty-acid--CoA ligase FadD2 | - |
| C6H33_RS07435 | 1547766..1549457 | + | 1692 | WP_011268682.1 | long-chain-fatty-acid--CoA ligase FadD1 | - |
| C6H33_RS07440 | 1549775..1550065 | - | 291 | WP_011268681.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| C6H33_RS07445 | 1550055..1550300 | - | 246 | WP_003402372.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| C6H33_RS07450 | 1550474..1554385 | + | 3912 | WP_104724379.1 | ATP-dependent RNA helicase HrpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11010.01 Da Isoelectric Point: 10.7294
>T293861 WP_011268681.1 NZ_LT962481:c1550065-1549775 [Pseudomonas syringae pv. syringae]
MTFKLEFLPSALKEWEKLGHTIRVQLKKKLLERLGLPRIPGDALHGMPDHYKIKLRSAGYRLVYRVEEDRVVVTVVAVGK
RERGNIYDSAKGRLGP
MTFKLEFLPSALKEWEKLGHTIRVQLKKKLLERLGLPRIPGDALHGMPDHYKIKLRSAGYRLVYRVEEDRVVVTVVAVGK
RERGNIYDSAKGRLGP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q4ZPQ9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3M2V2W1 |