Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 106608..107251 | Replicon | plasmid HDIAp1 |
Accession | NZ_LT960615 | ||
Organism | Hartmannibacter diazotrophicus strain E19T |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | HDIA_RS25005 | Protein ID | WP_099559221.1 |
Coordinates | 106608..106997 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | HDIA_RS25010 | Protein ID | WP_099559222.1 |
Coordinates | 106997..107251 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HDIA_RS24975 | 102025..102999 | + | 975 | WP_099559245.1 | NAD(P)-binding domain-containing protein | - |
HDIA_RS25550 | 103204..103347 | - | 144 | WP_162292712.1 | hypothetical protein | - |
HDIA_RS24980 | 103543..103866 | - | 324 | WP_099559217.1 | hypothetical protein | - |
HDIA_RS24990 | 104879..105127 | + | 249 | WP_099559218.1 | plasmid stabilization protein | - |
HDIA_RS24995 | 105124..105537 | + | 414 | WP_099559219.1 | type II toxin-antitoxin system VapC family toxin | - |
HDIA_RS25000 | 105562..106611 | - | 1050 | WP_099559220.1 | site-specific integrase | - |
HDIA_RS25005 | 106608..106997 | - | 390 | WP_099559221.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
HDIA_RS25010 | 106997..107251 | - | 255 | WP_099559222.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
HDIA_RS25015 | 107534..108373 | + | 840 | WP_099559223.1 | DUF1403 family protein | - |
HDIA_RS25020 | 108407..111382 | - | 2976 | WP_099559224.1 | Tn3 family transposase | - |
HDIA_RS25025 | 111536..112120 | + | 585 | WP_099559225.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..122332 | 122332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14289.12 Da Isoelectric Point: 5.1814
>T293859 WP_099559221.1 NZ_LT960615:c106997-106608 [Hartmannibacter diazotrophicus]
MVIDTSAIVAIFFNEPDAMTYRERIAADPIRLISAATLLEASMVIEGRFGEAGGAEFDLWLHKAEVEVVAVNHEHADQAR
RAWRRYGKGRHPASLNYGDCFSYALSSLSGEPLLFKGNDFKQTDIQAVS
MVIDTSAIVAIFFNEPDAMTYRERIAADPIRLISAATLLEASMVIEGRFGEAGGAEFDLWLHKAEVEVVAVNHEHADQAR
RAWRRYGKGRHPASLNYGDCFSYALSSLSGEPLLFKGNDFKQTDIQAVS
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|