Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 5213867..5214408 | Replicon | chromosome |
Accession | NZ_LT960614 | ||
Organism | Hartmannibacter diazotrophicus strain E19T |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | HDIA_RS23975 | Protein ID | WP_099558521.1 |
Coordinates | 5213867..5214190 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | HDIA_RS23980 | Protein ID | WP_099558522.1 |
Coordinates | 5214187..5214408 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HDIA_RS23955 | 5210478..5210999 | - | 522 | WP_099558517.1 | FixH family protein | - |
HDIA_RS23960 | 5211125..5212573 | - | 1449 | WP_099558518.1 | cytochrome c oxidase accessory protein CcoG | - |
HDIA_RS23965 | 5212962..5213489 | + | 528 | WP_099558519.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
HDIA_RS23970 | 5213498..5213833 | - | 336 | WP_099558520.1 | hypothetical protein | - |
HDIA_RS23975 | 5213867..5214190 | - | 324 | WP_099558521.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
HDIA_RS23980 | 5214187..5214408 | - | 222 | WP_099558522.1 | antitoxin MazE family protein | Antitoxin |
HDIA_RS23985 | 5214502..5215086 | - | 585 | WP_099558523.1 | NAD(P)H-dependent oxidoreductase | - |
HDIA_RS23990 | 5215218..5216090 | - | 873 | WP_099558524.1 | cytochrome-c oxidase, cbb3-type subunit III | - |
HDIA_RS23995 | 5216094..5216249 | - | 156 | WP_099558525.1 | cbb3-type cytochrome c oxidase subunit 3 | - |
HDIA_RS24000 | 5216260..5216994 | - | 735 | WP_099558526.1 | cytochrome-c oxidase, cbb3-type subunit II | - |
HDIA_RS24005 | 5217006..5218628 | - | 1623 | WP_099558527.1 | cytochrome-c oxidase, cbb3-type subunit I | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11630.62 Da Isoelectric Point: 10.2912
>T293858 WP_099558521.1 NZ_LT960614:c5214190-5213867 [Hartmannibacter diazotrophicus]
MRRGDLVTVAISGDFGKPRPALIVQSDQFEASATVTVLLLSGTLIDAPLIRIRVDPTPENGLNKPSQIMIDKIMTVRREK
LSAPFGRLDNDLLVAVNRSLALFLGFG
MRRGDLVTVAISGDFGKPRPALIVQSDQFEASATVTVLLLSGTLIDAPLIRIRVDPTPENGLNKPSQIMIDKIMTVRREK
LSAPFGRLDNDLLVAVNRSLALFLGFG
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|