Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1665047..1665694 | Replicon | chromosome |
Accession | NZ_LT960612 | ||
Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | VTAP4600_RS24425 | Protein ID | WP_102525281.1 |
Coordinates | 1665293..1665694 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | VTAP4600_RS24420 | Protein ID | WP_102524061.1 |
Coordinates | 1665047..1665280 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VTAP4600_RS24405 | 1662073..1662954 | - | 882 | WP_102525279.1 | DoxX family protein | - |
VTAP4600_RS24410 | 1663001..1664188 | - | 1188 | WP_102525280.1 | MFS transporter | - |
VTAP4600_RS24415 | 1664293..1664577 | - | 285 | WP_197708686.1 | hypothetical protein | - |
VTAP4600_RS24420 | 1665047..1665280 | + | 234 | WP_102524061.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
VTAP4600_RS24425 | 1665293..1665694 | + | 402 | WP_102525281.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
VTAP4600_RS26110 | 1665712..1665813 | + | 102 | Protein_1437 | DNA mismatch repair protein MutT | - |
VTAP4600_RS24430 | 1666035..1666871 | + | 837 | WP_102525282.1 | AraC family transcriptional regulator | - |
VTAP4600_RS24435 | 1666942..1667724 | + | 783 | WP_102525283.1 | AzlC family ABC transporter permease | - |
VTAP4600_RS24440 | 1667724..1668035 | + | 312 | WP_102525284.1 | AzlD domain-containing protein | - |
VTAP4600_RS24445 | 1668227..1668742 | + | 516 | WP_102525285.1 | peptide deformylase | - |
VTAP4600_RS24450 | 1668818..1669138 | - | 321 | WP_102525286.1 | heavy metal-binding domain-containing protein | - |
VTAP4600_RS24455 | 1669355..1670098 | + | 744 | WP_102525287.1 | phosphatase | - |
VTAP4600_RS24460 | 1670151..1670534 | - | 384 | WP_102525288.1 | VOC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14788.33 Da Isoelectric Point: 7.8042
>T293853 WP_102525281.1 NZ_LT960612:1665293-1665694 [Vibrio tapetis subsp. tapetis]
MLDTCICSFIMREQPIAVLKMLQDVVGKQHRIVISAITYQEMQYGLLGKKASPKHAVLVAEFLKRVDEILPWDKVAVDAT
TEVKRSLMAKGTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWVH
MLDTCICSFIMREQPIAVLKMLQDVVGKQHRIVISAITYQEMQYGLLGKKASPKHAVLVAEFLKRVDEILPWDKVAVDAT
TEVKRSLMAKGTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWVH
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|