Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 1237784..1238580 | Replicon | chromosome |
Accession | NZ_LT960612 | ||
Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | VTAP4600_RS22570 | Protein ID | WP_102524971.1 |
Coordinates | 1238050..1238580 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | B1KM02 |
Locus tag | VTAP4600_RS22565 | Protein ID | WP_005423939.1 |
Coordinates | 1237784..1238053 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VTAP4600_RS22535 | 1233606..1234451 | - | 846 | WP_102524969.1 | lysophospholipase | - |
VTAP4600_RS22555 | 1235601..1236623 | + | 1023 | WP_197708672.1 | hypothetical protein | - |
VTAP4600_RS22560 | 1236623..1237552 | + | 930 | WP_145958607.1 | hypothetical protein | - |
VTAP4600_RS22565 | 1237784..1238053 | + | 270 | WP_005423939.1 | DUF1778 domain-containing protein | Antitoxin |
VTAP4600_RS22570 | 1238050..1238580 | + | 531 | WP_102524971.1 | GNAT family N-acetyltransferase | Toxin |
VTAP4600_RS22575 | 1238753..1240495 | - | 1743 | WP_102524972.1 | alpha-galactosidase | - |
VTAP4600_RS22580 | 1240812..1242677 | + | 1866 | WP_102524973.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 19789.05 Da Isoelectric Point: 9.3099
>T293852 WP_102524971.1 NZ_LT960612:1238050-1238580 [Vibrio tapetis subsp. tapetis]
VSYSKAFKELDKSQHDRASFDCGEKELNGFIQTQAAKHMQAGISRTMVLPASVPLPNQKYPICSFYSIAPSSISRDTLPK
AMAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIKALEYLWEINSHMRAYAIVVDCFTEQAESFYAKYGFEVLCEING
RARMFIPMKTVGQLFT
VSYSKAFKELDKSQHDRASFDCGEKELNGFIQTQAAKHMQAGISRTMVLPASVPLPNQKYPICSFYSIAPSSISRDTLPK
AMAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIKALEYLWEINSHMRAYAIVVDCFTEQAESFYAKYGFEVLCEING
RARMFIPMKTVGQLFT
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|