Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 618776..619542 | Replicon | chromosome |
Accession | NZ_LT960612 | ||
Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | VTAP4600_RS19910 | Protein ID | WP_102524526.1 |
Coordinates | 618776..619273 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | VTAP4600_RS19915 | Protein ID | WP_102524527.1 |
Coordinates | 619270..619542 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VTAP4600_RS19900 | 615723..617252 | - | 1530 | WP_102521342.1 | transposase | - |
VTAP4600_RS19905 | 617788..618636 | + | 849 | WP_102524525.1 | hypothetical protein | - |
VTAP4600_RS19910 | 618776..619273 | - | 498 | WP_102524526.1 | GNAT family N-acetyltransferase | Toxin |
VTAP4600_RS19915 | 619270..619542 | - | 273 | WP_102524527.1 | DUF1778 domain-containing protein | Antitoxin |
VTAP4600_RS26005 | 619814..619990 | + | 177 | WP_172443187.1 | hypothetical protein | - |
VTAP4600_RS19925 | 619995..620399 | - | 405 | WP_102524528.1 | hypothetical protein | - |
VTAP4600_RS19930 | 620386..620622 | - | 237 | WP_102524529.1 | hypothetical protein | - |
VTAP4600_RS19935 | 620828..620998 | + | 171 | Protein_540 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VTAP4600_RS26010 | 621184..621360 | + | 177 | WP_172443188.1 | hypothetical protein | - |
VTAP4600_RS19945 | 621487..621903 | + | 417 | WP_102524530.1 | GFA family protein | - |
VTAP4600_RS19950 | 622264..622584 | + | 321 | WP_102524531.1 | hypothetical protein | - |
VTAP4600_RS19955 | 622631..623002 | + | 372 | WP_102524532.1 | DUF805 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18616.27 Da Isoelectric Point: 8.8085
>T293851 WP_102524526.1 NZ_LT960612:c619273-618776 [Vibrio tapetis subsp. tapetis]
MMNTVLLEKAKHDRNRFNCGIEALNNYLKIMASQQAKKDNTRTFVLEDDNDNSHIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQTFQDSENKLFITISDV
RANLG
MMNTVLLEKAKHDRNRFNCGIEALNNYLKIMASQQAKKDNTRTFVLEDDNDNSHIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQTFQDSENKLFITISDV
RANLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|