Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 22135..22783 | Replicon | chromosome |
Accession | NZ_LT960612 | ||
Organism | Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | VTAP4600_RS17270 | Protein ID | WP_102525281.1 |
Coordinates | 22135..22536 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | VTAP4600_RS17275 | Protein ID | WP_102524061.1 |
Coordinates | 22550..22783 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VTAP4600_RS17235 | 17322..18527 | - | 1206 | WP_102524054.1 | DUF1611 domain-containing protein | - |
VTAP4600_RS17245 | 18911..20038 | - | 1128 | WP_102524056.1 | HD domain-containing protein | - |
VTAP4600_RS17250 | 20161..20427 | - | 267 | WP_102524057.1 | hypothetical protein | - |
VTAP4600_RS17255 | 20438..20656 | - | 219 | WP_102524058.1 | hypothetical protein | - |
VTAP4600_RS17260 | 20686..21150 | - | 465 | WP_102524059.1 | hypothetical protein | - |
VTAP4600_RS17270 | 22135..22536 | - | 402 | WP_102525281.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
VTAP4600_RS17275 | 22550..22783 | - | 234 | WP_102524061.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
VTAP4600_RS17280 | 23250..23925 | + | 676 | Protein_22 | SDR family oxidoreductase | - |
VTAP4600_RS17285 | 23986..25173 | + | 1188 | WP_102524062.1 | MFS transporter | - |
VTAP4600_RS17290 | 25220..26101 | + | 882 | WP_102524063.1 | DoxX family protein | - |
VTAP4600_RS17295 | 26192..26758 | + | 567 | Protein_25 | glutaredoxin 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 10386..39273 | 28887 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14788.33 Da Isoelectric Point: 7.8042
>T293850 WP_102525281.1 NZ_LT960612:c22536-22135 [Vibrio tapetis subsp. tapetis]
MLDTCICSFIMREQPIAVLKMLQDVVGKQHRIVISAITYQEMQYGLLGKKASPKHAVLVAEFLKRVDEILPWDKVAVDAT
TEVKRSLMAKGTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWVH
MLDTCICSFIMREQPIAVLKMLQDVVGKQHRIVISAITYQEMQYGLLGKKASPKHAVLVAEFLKRVDEILPWDKVAVDAT
TEVKRSLMAKGTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWVH
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|