Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 492967..493495 Replicon chromosome
Accession NZ_LT960611
Organism Vibrio tapetis subsp. tapetis isolate Vibrio tapetis CECT4600

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag VTAP4600_RS02285 Protein ID WP_102521311.1
Coordinates 492967..493257 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID K5UYY9
Locus tag VTAP4600_RS02290 Protein ID WP_004730320.1
Coordinates 493247..493495 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VTAP4600_RS02260 488101..490026 + 1926 WP_102521308.1 threonine--tRNA ligase -
VTAP4600_RS02265 490030..490581 + 552 WP_102521309.1 translation initiation factor IF-3 -
VTAP4600_RS02270 490686..490880 + 195 WP_102523868.1 50S ribosomal protein L35 -
VTAP4600_RS02275 490924..491277 + 354 WP_102521310.1 50S ribosomal protein L20 -
VTAP4600_RS02280 491365..492327 - 963 Protein_422 integron integrase -
VTAP4600_RS02285 492967..493257 - 291 WP_102521311.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
VTAP4600_RS02290 493247..493495 - 249 WP_004730320.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
VTAP4600_RS02295 493679..494878 - 1200 WP_102521312.1 IS4 family transposase -
VTAP4600_RS02300 495018..495213 - 196 Protein_426 type II toxin-antitoxin system RelE/ParE family toxin -
VTAP4600_RS26070 495339..495494 - 156 WP_197708653.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
VTAP4600_RS02310 495889..496299 + 411 WP_102523869.1 hypothetical protein -
VTAP4600_RS02315 497025..497327 + 303 WP_102521313.1 hypothetical protein -
VTAP4600_RS25875 497911..498063 + 153 WP_172443050.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11204.20 Da        Isoelectric Point: 10.7726

>T293844 WP_102521311.1 NZ_LT960611:c493257-492967 [Vibrio tapetis subsp. tapetis]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLTERLANPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRIDN

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9109.39 Da        Isoelectric Point: 3.9610

>AT293844 WP_004730320.1 NZ_LT960611:c493495-493247 [Vibrio tapetis subsp. tapetis]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLTIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0L1LA33

References