Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2309916..2310544 | Replicon | chromosome |
Accession | NZ_LT934425 | ||
Organism | Candidatus Kuenenia stuttgartiensis isolate kuenenia_mbr1_ru-nijmegen |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | KSMBR1_RS10615 | Protein ID | WP_099325311.1 |
Coordinates | 2310143..2310544 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | KSMBR1_RS10610 | Protein ID | WP_099325310.1 |
Coordinates | 2309916..2310143 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KSMBR1_RS10600 | 2307043..2308545 | + | 1503 | WP_099325308.1 | DUF2779 domain-containing protein | - |
KSMBR1_RS10605 | 2308851..2309324 | + | 474 | WP_099325309.1 | HEAT repeat domain-containing protein | - |
KSMBR1_RS10610 | 2309916..2310143 | + | 228 | WP_099325310.1 | antitoxin | Antitoxin |
KSMBR1_RS10615 | 2310143..2310544 | + | 402 | WP_099325311.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
KSMBR1_RS10620 | 2310956..2311540 | - | 585 | WP_099325312.1 | MBL fold metallo-hydrolase | - |
KSMBR1_RS10625 | 2311598..2312242 | - | 645 | WP_099325313.1 | pentapeptide repeat-containing protein | - |
KSMBR1_RS10630 | 2312282..2313079 | - | 798 | WP_099325314.1 | HD domain-containing protein | - |
KSMBR1_RS10635 | 2313198..2315081 | - | 1884 | WP_099324133.1 | IS1634 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14909.40 Da Isoelectric Point: 7.8719
>T293841 WP_099325311.1 NZ_LT934425:2310143-2310544 [Candidatus Kuenenia stuttgartiensis]
MKCMLDTNICIYLIKRKNPKILAYLKKHDIGEVGISSITLAELQYGVANSNYIQRNREALHEFILPLEIADFDEKVAEVY
GNVRANLEKAGTPIGSMDMLIGAHAMSLGVTLVSNNTREFNRIKGLKVVDWTI
MKCMLDTNICIYLIKRKNPKILAYLKKHDIGEVGISSITLAELQYGVANSNYIQRNREALHEFILPLEIADFDEKVAEVY
GNVRANLEKAGTPIGSMDMLIGAHAMSLGVTLVSNNTREFNRIKGLKVVDWTI
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|